KEGG   Mycobacterium tuberculosis H37Rv: Rv3106Help
Entry
Rv3106            CDS       T00015                                 

Gene name
fprA
Definition
(RefSeq) NADPH-ferredoxin reductase FprA
  KO
K00528  
ferredoxin/flavodoxin---NADP+ reductase [EC:1.18.1.2 1.19.1.1]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Brite
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.18  Acting on iron-sulfur proteins as donors
   1.18.1  With NAD+ or NADP+ as acceptor
    1.18.1.2  ferredoxin---NADP+ reductase
     Rv3106 (fprA)
  1.19  Acting on reduced flavodoxin as donor
   1.19.1  With NAD+ or NADP+ as acceptor
    1.19.1.1  flavodoxin---NADP+ reductase
     Rv3106 (fprA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
3474007..3475377
Genome map
AA seq 456 aa AA seqDB search
MRPYYIAIVGSGPSAFFAAASLLKAADTTEDLDMAVDMLEMLPTPWGLVRSGVAPDHPKI
KSISKQFEKTAEDPRFRFFGNVVVGEHVQPGELSERYDAVIYAVGAQSDRMLNIPGEDLP
GSIAAVDFVGWYNAHPHFEQVSPDLSGARAVVIGNGNVALDVARILLTDPDVLARTDIAD
HALESLRPRGIQEVVIVGRRGPLQAAFTTLELRELADLDGVDVVIDPAELDGITDEDAAA
VGKVCKQNIKVLRGYADREPRPGHRRMVFRFLTSPIEIKGKRKVERIVLGRNELVSDGSG
RVAAKDTGEREELPAQLVVRSVGYRGVPTPGLPFDDQSGTIPNVGGRINGSPNEYVVGWI
KRGPTGVIGTNKKDAQDTVDTLIKNLGNAKEGAECKSFPEDHADQVADWLAARQPKLVTS
AHWQVIDAFERAAGEPHGRPRVKLASLAELLRIGLG
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgcgtccctattacatcgccatcgtgggctccgggccgtcggcgttcttcgccgcggca
tccttgctgaaggccgccgacacgaccgaggacctcgacatggccgtcgacatgctggag
atgttgccgactccctgggggctggtgcgctccggggtcgcgccggatcaccccaagatc
aagtcgatcagcaagcaattcgaaaagacggccgaggacccccgcttccgcttcttcggc
aatgtggtcgtcggcgaacacgtccagcccggcgagctctccgagcgctacgacgccgtg
atctacgccgtcggcgcgcagtccgatcgcatgttgaacatccccggtgaggacctgccg
ggcagtatcgccgccgtcgatttcgtcggctggtacaacgcacatccacacttcgagcag
gtatcacccgatctgtcgggcgcccgggccgtagttatcggcaatggaaacgtcgcgcta
gacgtggcacggattctgctcaccgatcccgacgtgttggcacgcaccgatatcgccgat
cacgctttggaatcgctacgcccacgcggtatccaggaggtggtgatcgtcgggcgccga
ggtccgctgcaggccgcgttcaccacgttggagttgcgcgagctggccgacctcgacggg
gttgacgtggtgatcgatccggcggagctggacggcattaccgacgaggacgcggccgcg
gtgggcaaggtctgcaagcagaacatcaaggtgctgcgtggctatgcggaccgcgaaccc
cgcccgggacaccgccgcatggtgttccggttcttgacctctccgatcgagatcaagggc
aagcgcaaagtggagcggatcgtgctgggccgcaacgagctggtctccgacggcagcggg
cgagtggcggccaaggacaccggcgagcgcgaggagctgccagctcagctggtcgtgcgg
tcggtcggctaccgcggggtgcccacgcccgggctgccgttcgacgaccagagcgggacc
atccccaacgtcggcggccgaatcaacggcagccccaacgaatacgtcgtcgggtggatc
aagcgcgggccgaccggggtgatcgggaccaacaagaaggacgcccaagacaccgtcgac
accttgatcaagaatcttggcaacgccaaggagggcgccgagtgcaagagctttccggaa
gatcatgccgaccaggtggccgactggctagcagcacgccagccgaagctggtcacgtcg
gcccactggcaggtgatcgacgctttcgagcgggccgccggcgagccgcacgggcgtccc
cgggtcaagttggccagcctggccgagctgttgcggattgggctcggctga

DBGET integrated database retrieval system