KEGG   Mycobacterium tuberculosis H37Rv: Rv3109Help
Entry
Rv3109            CDS       T00015                                 

Gene name
moaA1
Definition
(RefSeq) cyclic pyranopterin monophosphate synthase
  KO
K03639  
GTP 3',8-cyclase [EC:4.1.99.22]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Folate biosynthesis
Metabolic pathways
Sulfur relay system
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Rv3109 (moaA1)
 Genetic Information Processing
  Folding, sorting and degradation
   04122 Sulfur relay system
    Rv3109 (moaA1)
Enzymes [BR:mtu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.22  GTP 3',8-cyclase
     Rv3109 (moaA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
3477649..3478728
Genome map
AA seq 359 aa AA seqDB search
MSTPTLPDMVAPSPRVRVKDRCRRMMGDLRLSVIDQCNLRCRYCMPEEHYTWLPRQDLLS
VKEISAIVDVFLSVGVSKVRITGGEPLIRPDLPEIVRTLSAKVGEDSGLRDLAITTNGVL
LADRVDGLKAAGMKRITVSLDTLQPERFKAISQRNSHDKVIAGIKAVAAAGFTDTKIDTT
VMRGANHDELADLIEFARTVNAEVRFIEYMDVGGATHWAWEKVFTKANMLESLEKRYGRI
EPLPKHDTAPANRYALPDGTTFGIIASTTEPFCATCDRSRLTADGLWLHCLYAISGINLR
EPLRAGATHDDLVETVTTGWRRRTDRGAEQRLAQRERGVFLPLSTLKADPHLEMHTRGG
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgagtacgcctacgctgcctgatatggtagctccatccccgagagtgcgagtaaaagac
cgttgtcgccggatgatgggggacctacgcctttccgttatcgatcagtgcaatttgcga
tgccgttattgtatgcccgaagagcactacacatggttgccgcggcaagatttgctatcc
gtcaaagaaatcagcgccattgtagatgttttcctttccgttggggtaagtaaagttcga
atcaccggtggcgaaccgctgatccgcccagatttgccggaaatagtgaggacattgagc
gcaaaggtcggcgaagattcaggtctgagagacttagcgatcacgacgaacggcgtcctt
ctcgccgaccgcgttgacggcctgaaggctgcgggtatgaaacgcatcactgtcagtctt
gatacgttgcaacccgagcgcttcaaggcgataagtcagcgtaatagccacgataaggtc
atcgcgggtatcaaggctgtcgcagccgcgggatttacggacacaaaaatagacacaacg
gtgatgcgtggtgccaatcacgatgagctggctgatctgatcgaattcgctcggactgtt
aacgcggaagtcaggttcattgagtacatggacgtcggcggcgcaactcactgggcatgg
gagaaggtctttaccaaagcgaacatgctcgagtcccttgagaaacggtatggacgtatt
gagcctttgcccaaacatgatacggcgcccgccaatcgatatgcgcttccggacggaact
accttcggaattatcgcgtcgacaacggagccattctgcgcaacctgtgaccgttcacgg
ttgaccgccgatggcttatggctgcattgcttgtacgcaatatcgggtatcaacctaagg
gagccgctgcgtgcaggcgcgactcacgatgacttggtggaaaccgtgacaaccggatgg
cggcgacgaacggatcgcggagcagagcagcgtcttgcccaacgcgagcgcggagtgttc
ctgccattaagcacgttaaaggccgacccgcatctggagatgcacaccaggggcgggtaa

DBGET integrated database retrieval system