KEGG   Mycobacterium tuberculosis H37Rv: Rv3119Help
Entry
Rv3119            CDS       T00015                                 

Gene name
moaE1
Definition
(RefSeq) molybdopterin synthase catalytic subunit 1
  KO
K03635  
molybdopterin synthase catalytic subunit [EC:2.8.1.12]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Folate biosynthesis
Metabolic pathways
Sulfur relay system
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Rv3119 (moaE1)
 Genetic Information Processing
  Folding, sorting and degradation
   04122 Sulfur relay system
    Rv3119 (moaE1)
Enzymes [BR:mtu01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.12  molybdopterin synthase
     Rv3119 (moaE1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
3485132..3485575
Genome map
AA seq 147 aa AA seqDB search
MANVVAEGAYPYCRLTDQPLSVDEVLAAVSGPEQGGIVIFVGNVRDHNAGHDVTRLFYEA
YPPMVIRTLMSIIGRCEDKAEGVRVAVAHRTGELQIGDAAVVIGASAPHRAEAFDAARMC
IELLKQEVPIWKKEFSSTGAEWVGDRP
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atggccaatgtggtagctgaaggtgcctacccttactgtcggctcactgatcagccgctg
agtgtggacgaagtgctagccgccgtctcgggccccgaacaaggcggcattgtcatattt
gtgggaaacgtgcgtgaccacaatgccgggcatgatgtcacgcggttgttctacgaggcg
tatccgccgatggtgattcggacattgatgtcgatcatcggacggtgtgaagacaaggcc
gagggtgtccgcgttgctgtcgcgcaccggaccggtgaattgcaaatcggtgatgccgcg
gtcgttattggcgcgtcagctccccaccgtgcggaggcatttgacgccgcgcgtatgtgt
atcgagttgcttaagcaggaagtgccgatttggaagaaggaattcagctcgaccggtgct
gaatgggtcggcgatagaccatga

DBGET integrated database retrieval system