KEGG   Mycobacterium tuberculosis H37Rv: Rv3130cHelp
Entry
Rv3130c           CDS       T00015                                 

Gene name
tgs1
Definition
(RefSeq) diacyglycerol O-acyltransferase
Organism
mtu  Mycobacterium tuberculosis H37Rv
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
complement(3494975..3496366)
Genome map
AA seq 463 aa AA seqDB search
MNHLTTLDAGFLKAEDVDRHVSLAIGALAVIEGPAPDQEAFLSSLAQRLRPCTRFGQRLR
LRPFDLGAPKWVDDPDFDLGRHVWRIALPRPGNEDQLFELIADLMARRLDRGRPLWEVWV
IEGLADSKWAILTKLHHCMADGIAATHLLAGLSDESMSDSFASNIHTTMQSQSASVRRGG
FRVNPSEALTASTAVMAGIVRAAKGASEIAAGVLSPAASSLNGPISDLRRYSAAKVPLAD
VEQVCRKFDVTINDVALAAITESYRNVLIQRGERPRFDSLRTLVPVSTRSNSALSKTDNR
VSLMLPNLPVDQENPLQRLRIVHSRLTRAKAGGQRQFGNTLMAIANRLPFPMTAWAVGLL
MRLPQRGVVTVATNVPGPRRPLQIMGRRVLDLYPVSPIAMQLRTSVAMLSYADDLYFGIL
ADYDVVADAGQLARGIEDAVARLVAISKRRKVTRRRGALSLVV
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgaatcacctaacgacacttgacgccgggtttctcaaggcagaagacgtggatcggcac
gtgagtctggcaatcggcgctctggcggtcatcgaggggccggctcccgatcaggaagcc
ttcttatcgtcgctcgctcaacgcctacgtccctgtacccggttcgggcagcggttacgc
ctgcgcccgttcgacctcggtgcacccaaatgggtggacgatcccgacttcgatcttggc
cgtcatgtgtggcgcatcgccttgccgcggcctggcaacgaagaccagttattcgagctg
atcgccgatctgatggcgcgtcgtttggaccggggtcgaccgctgtgggaggtctgggtc
atcgaaggcctggcggacagcaagtgggcgatcctgaccaaactgcaccactgcatggcc
gacggaatcgcggcgactcacctgctagctgggctctccgatgaaagtatgagcgacagc
ttcgcgagcaacatccacacgaccatgcagtcgcaatccgcatctgtgcggcggggtgga
ttccgtgtcaatccaagcgaggcgttgaccgcgtcgaccgccgtgatggcaggcatcgtt
cgcgcggccaagggtgccagtgagatcgcggccggcgtgctaagtcccgccgcgtcgtcg
ttgaacgggccgatcagtgatttgcgtcgctacagcgcagcaaaggtccctctcgccgac
gtcgaacaggtgtgccggaaattcgacgtcaccatcaatgatgttgcgcttgccgcgatt
acggaaagctaccgcaacgtcctcatccagcggggtgagcggcctaggtttgattcgctg
cgtacgctagtgccggtctcgacgcgttccaacagcgctttgagcaagaccgataaccgt
gtttcgttaatgctgcccaacctgccggtggatcaagagaacccgctgcagcggctgcgg
atcgtgcactcgcggctgactcgggccaaggcggggggacagagacaattcggaaatact
ttgatggcgattgccaaccgccttccgttccccatgaccgcatgggcggtcgggctgttg
atgcggctgccgcagcgtggtgttgtcaccgtggcgacaaatgtgccgggtccacgacgg
ccgctgcagattatgggcagacgggtgcttgacctatacccggtttcgccgatcgcgatg
caactgcgcaccagtgtcgcgatgctcagctacgccgacgacctgtacttcgggatcctg
gccgactacgacgtggtagcagatgccggccagctggcgcgaggaattgaagacgccgtc
gcacggctggtggcgatcagtaagcggcgcaaggtgactcgcaggcgcggagcgctatcg
ctggttgtgtga

DBGET integrated database retrieval system