KEGG   Mycobacterium tuberculosis H37Rv: Rv3140Help
Entry
Rv3140            CDS       T00015                                 

Gene name
fadE23
Definition
(RefSeq) acyl-CoA dehydrogenase FadE23
  KO
K00249  
acyl-CoA dehydrogenase [EC:1.3.8.7]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rv3140 (fadE23)
   01212 Fatty acid metabolism
    Rv3140 (fadE23)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Rv3140 (fadE23)
  Lipid metabolism
   00071 Fatty acid degradation
    Rv3140 (fadE23)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Rv3140 (fadE23)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Rv3140 (fadE23)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.7  medium-chain acyl-CoA dehydrogenase
     Rv3140 (fadE23)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
3506790..3507995
Genome map
AA seq 401 aa AA seqDB search
MAINLELPRKLQAIIVKTHQGAAEMMRPIARKYDLKEHAYPVELDTLINLFEGAAESFNF
AGAHSLRDEDEGKDENHNGANMAAVVQTMEASWGDVAMMLSLPYQGLGNAAISAVATDEQ
LERLGKVWAAMAITEPEFGSDSAAVSTTATLDGDEYVINGEKIFVTAGSRATHIVVWATL
DKSLGRPAIKSFIVPREHPGVTVERLEHKLGIKGSDTAVIRFDNARIPKGNLLGNPEIEV
GKGFAGVMETFDNTRPIVAAMAVGIGRAALEEIRSVLTGAGVEISYDKPSHTQSAAAAEF
LRMEADWEASYLLSLRAAWQADNNIPNSKEASMSKAKAGRMASDVTCKTVELAGTTGYSE
QSLLEKWARDSKILDIFEGTQQIQQLVVARRLLGLSSSELK
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggcaataaatctggaactgccgcgcaagctgcaggcgatcatcgtcaagacccatcag
ggcgctgcggagatgatgcggccgatagcccgcaagtacgacctgaaggaacatgcctac
ccggtcgaactcgacaccctgatcaatttgttcgagggcgccgccgaatcgttcaacttt
gccggagcccattcgcttcgcgacgaggacgaaggcaaggacgaaaaccacaacggtgcc
aacatggccgccgtggtacagacgatggaggccagctggggcgacgtcgcgatgatgctg
tcgctgccctatcaggggctgggtaacgcagccatctccgcggtagccaccgacgagcag
ctggagcggctgggcaaagtgtgggcagcgatggccatcaccgaaccggaattcggatcg
gactcggcggcagtgtcgacgaccgccaccctcgacggcgacgagtacgtgatcaacggc
gagaagatctttgtcaccgccggttcccgcgccacccacatcgtggtctgggccacgctg
gacaaatccttgggccgcccggcgattaagtcgttcatcgtgccccgtgagcatcccggc
gtgaccgtcgaacgacttgaacacaaactcggcatcaagggttctgatactgcggtgatc
cggttcgacaacgcccgtatccccaagggcaacctacttgggaacccggaaatcgaggtc
ggcaagggctttgccggggtgatggagaccttcgacaacacccggccgattgtggccgcc
atggccgtcgggatcggccgtgccgcactggaggaaatccgtagtgtcctcaccggggcc
ggcgtggagatctcctacgacaagccctcacacacccagagcgccgcggccgccgagttc
ctgcggatggaggccgactgggaggccagctacctactgtccctgcgcgcagcctggcag
gccgacaacaacatccccaactccaaagaagcctcgatgagcaaggccaaggcgggccgg
atggccagcgacgtcacctgcaaaaccgtcgaattggcaggaactaccgggtattccgag
caatcactgctggagaagtgggcccgcgactccaagatcctggacatcttcgagggcacc
cagcagatccagcagctggtggtcgcacgccgactgttgggcctgtcgtcgtccgagctc
aaatag

DBGET integrated database retrieval system