KEGG   Mycobacterium tuberculosis H37Rv: Rv3199cHelp
Entry
Rv3199c           CDS       T00015                                 

Gene name
nudC
Definition
(RefSeq) NADH pyrophosphatase
  KO
K03426  
NAD+ diphosphatase [EC:3.6.1.22]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Rv3199c (nudC)
Enzymes [BR:mtu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.22  NAD+ diphosphatase
     Rv3199c (nudC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
complement(3571602..3572543)
Genome map
AA seq 313 aa AA seqDB search
MTNVSGVDFQLRSVPLLSRVGADRADRLRTDMEAAAAGWPGAALLRVDSRNRVLVANGRV
LLGAAIELADKPPPEAVFLGRVEGGRHVWAVRAALQPIADPDIPAEAVDLRGLGRIMDDT
SSQLVSSASALLNWHDNARFSALDGAPTKPARAGWSRVNPITGHEEFPRIDPAVICLVHD
GADRAVLARQAAWPERMFSLLAGFVEAGESFEVCVAREIREEIGLTVRDVRYLGSQQWPF
PRSLMVGFHALGDPDEEFSFSDGEIAEAAWFTRDEVRAALAAGDWSSASESKLLLPGSIS
IARVIIESWAACE
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
gtgacgaacgtaagcggcgtggattttcagctgagaagcgttccgttgctttcgcgcgtc
ggcgccgaccgggccgaccggctgaggaccgacatggaggcggccgccgcgggatggcca
ggcgcggcattgctgcgggtggattcccgcaatcgcgtgctggtcgccaacggccgggtg
ttgcttggcgcggccatcgagctggccgacaagccaccgccagaggcggtattcctgggt
cgcgtcgagggcggccgccacgtctgggcggtgcgggcagcgctgcagccgatcgctgat
cccgacataccagccgaggcggtggaccttcgtgggctcggccgaatcatggacgacacc
agcagccaactggtgtcgtcggcatcggcgctgttgaactggcatgacaacgcacgattc
agcgccctagacggcgcgccgacgaaaccggccagggccggctggtcacgggtcaacccg
atcaccggtcatgaggagttcccccgtatcgacccggcggtgatctgcctggttcacgac
ggcgctgatcgtgccgtgttggctcgccaggcggcgtggccggaacggatgttctcgctg
ttggctggctttgtcgaggccggagagtcgttcgaagtctgcgtcgcccgggagatccgc
gaggaaatcggcctgaccgttcgcgatgtgcgctatctgggcagccagcagtggccgttc
ccgcggtcgttaatggttggctttcatgccttgggtgacccggatgaggagttctcgttc
agcgacggcgaaatcgccgaagccgcgtggttcacccgcgatgaggtgcgcgcagcgctt
gccgccggcgattggtccagtgcgtcggagtcgaaactgctactgcccgggtcgatctcg
atcgcccgcgtgatcatcgaatcgtgggcagcgtgcgaatga

DBGET integrated database retrieval system