KEGG   Mycobacterium tuberculosis H37Rv: Rv3206cHelp
Entry
Rv3206c           CDS       T00015                                 

Gene name
moeB1
Definition
(RefSeq) adenylyltransferase/sulfurtransferase MoeZ
  KO
K21147  
sulfur-carrier protein adenylyltransferase/sulfurtransferase [EC:2.7.7.80 2.7.7.- 2.8.1.11 2.8.1.-]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Sulfur relay system
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04122 Sulfur relay system
    Rv3206c (moeB1)
Enzymes [BR:mtu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.80  molybdopterin-synthase adenylyltransferase
     Rv3206c (moeB1)
    2.7.7.-  
     Rv3206c (moeB1)
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.11  molybdopterin synthase sulfurtransferase
     Rv3206c (moeB1)
    2.8.1.-  
     Rv3206c (moeB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
complement(3582532..3583710)
Genome map
AA seq 392 aa AA seqDB search
MSTSLPPLVEPASALSREEVARYSRHLIIPDLGVDGQKRLKNARVLVIGAGGLGAPTLLY
LAAAGVGTIGIVDFDVVDESNLQRQVIHGVADVGRSKAQSARDSIVAINPLIRVRLHELR
LAPSNAVDLFKQYDLILDGTDNFATRYLVNDAAVLAGKPYVWGSIYRFEGQASVFWEDAP
DGLGVNYRDLYPEPPPPGMVPSCAEGGVLGIICASVASVMGTEAIKLITGIGETLLGRLL
VYDALEMSYRTITIRKDPSTPKITELVDYEQFCGVVADDAAQAAKGSTITPRELRDWLDS
GRKLALIDVRDPVEWDIVHIDGAQLIPKSLINSGEGLAKLPQDRTAVLYCKTGVRSAEAL
AAVKKAGFSDAVHLQGGIVAWAKQMQPDMVMY
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgacatccttgccgccactagttgagccagcatccgcgctcagccgtgaagaggta
gctcgctacagccgccatctcatcattcctgacctgggtgttgacgggcagaagaggctc
aagaacgcgcgagtactggtgatcggcgccggcgggctcggagcgcccacgttattgtat
ctggccgccgccggcgtcggcaccatcggcatcgtcgacttcgatgtggttgacgagtcg
aacctgcagcgccaggtcatccatggggtagctgacgtcgggcgctccaaggctcagtcg
gcgcgcgattcgattgtcgcgatcaacccgctgatccgggtgcgactacacgagctgcgg
cttgcgccgagcaacgccgtcgacctgttcaagcagtacgacctgatcttggatggcacc
gacaacttcgccacccggtatctggtcaacgacgccgcggtgctggctggcaagccgtac
gtgtgggggtcgatttaccgcttcgagggccaggcatcggtgttttgggaggacgccccc
gacgggttgggtgtcaactaccgcgacctgtatcccgagccgccgccgccgggcatggtg
ccgtcctgtgctgaaggcggggtgctgggcattatctgtgcctcggtcgcatcggtgatg
ggcactgaggcgatcaagctgatcaccgggataggtgaaacactgcttggccggttgctg
gtgtacgacgcgctggagatgagctatcgcacgatcaccatccgcaaggacccatcgaca
ccgaagatcaccgagctggtcgactacgaacagttctgcggcgtggttgctgacgatgcc
gcccaggcggccaaaggttccaccatcacgccgcgcgagctgcgcgactggctggactcc
ggccgtaagctggcactgatcgacgttcgcgatcccgtggagtgggacatcgtgcatatc
gacggagcccaactgattccgaaatcgttgatcaactcgggtgagggtctggccaagctc
ccccaggaccgcaccgccgtgctgtactgcaagacgggcgtgcgctcggccgaggcattg
gctgcggtcaagaaagccggtttctccgacgcggtacacctgcagggtgggatcgtcgcg
tgggccaagcagatgcagcccgacatggtgatgtactag

DBGET integrated database retrieval system