KEGG   Mycobacterium tuberculosis H37Rv: Rv3214Help
Entry
Rv3214            CDS       T00015                                 

Gene name
gpm2
Definition
(RefSeq) phosphoglycerate mutase
  KO
K15634  
probable phosphoglycerate mutase [EC:5.4.2.12]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rv3214 (gpm2)
   01230 Biosynthesis of amino acids
    Rv3214 (gpm2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rv3214 (gpm2)
  Energy metabolism
   00680 Methane metabolism
    Rv3214 (gpm2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rv3214 (gpm2)
Enzymes [BR:mtu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.12  phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
     Rv3214 (gpm2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
3591646..3592257
Genome map
AA seq 203 aa AA seqDB search
MGVRNHRLLLLRHGETAWSTLGRHTGGTEVELTDTGRTQAELAGQLLGELELDDPIVICS
PRRRTLDTAKLAGLTVNEVTGLLAEWDYGSYEGLTTPQIRESEPDWLVWTHGCPAGESVA
QVNDRADSAVALALEHMSSRDVLFVSHGHFSRAVITRWVQLPLAEGSRFAMPTASIGICG
FEHGVRQLAVLGLTGHPQPIAAG
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgggcgtgcgcaaccaccgattgctactgctccgccacggcgagaccgcttggtcgacg
ctgggccggcacaccggcggtaccgaggtcgagctgaccgataccgggcgaacgcaggca
gagctggctggtcagctgctgggtgaactcgaacttgacgacccgattgtcatctgtagc
ccgcgtcgacggacgttggatactgccaagttggccggcctgacggtgaatgaggtaact
gggctgctcgccgaatgggattacggttcctatgagggccttacgacgccgcagatccgg
gaatccgaacccgattggctggtgtggacgcacggctgcccagctggagaaagcgtcgca
caggtaaacgatcgcgctgacagcgccgtcgcgctggccctggagcacatgtcctcacgc
gacgtgttgtttgtcagccatggccacttctcccgcgcggtgatcacgcgctgggtccag
ctaccgctcgccgaaggcagccgtttcgcgatgcccaccgcctcgatcgggatctgcggg
ttcgagcacggcgtgcgtcagctcgccgtgctcgggttgaccggtcatccgcagccgatc
gcagccgggtga

DBGET integrated database retrieval system