KEGG   Mycobacterium tuberculosis H37Rv: Rv3215Help
Entry
Rv3215            CDS       T00015                                 

Gene name
entC
Definition
(RefSeq) isochorismate synthase
  KO
K02361  
isochorismate synthase [EC:5.4.4.2]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Ubiquinone and other terpenoid-quinone biosynthesis
Biosynthesis of siderophore group nonribosomal peptides
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    Rv3215 (entC)
  Metabolism of terpenoids and polyketides
   01053 Biosynthesis of siderophore group nonribosomal peptides
    Rv3215 (entC)
Enzymes [BR:mtu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.4  Transferring hydroxy groups
    5.4.4.2  isochorismate synthase
     Rv3215 (entC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Position
3592254..3593372
Genome map
AA seq 372 aa AA seqDB search
MSAHVATLHPEPPFALCGPRGTLIARGVRTRYCDVRAAQAALRSGTAPILLGALPFDVSR
PAALMVPDGVLRARKLPDWPTGPLPKVRVAAALPPPADYLTRIGRARDLLAAFDGPLHKV
VLARAVQLTADAPLDARVLLRRLVVADPTAYGYLVDLTSAGNDDTGAALVGASPELLVAR
SGNRVMCKPFAGSAPRAADPKLDAANAAALASSAKNRHEHQLVVDTMRVALEPLCEDLTI
PAQPQLNRTAAVWHLCTAITGRLRNISTTAIDLALALHPTPAVGGVPTKAATELIAELEG
DRGFYAGAVGWCDGRGDGHWVVSIRCAQLSADRRAALAHAGGGIVAESDPDDELEETTTK
FATILTALGVEQ
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcacacgtggcaaccttgcacccagaaccaccgttcgcactgtgcggaccaaga
ggcaccctgattgcccgcggggtgcggacacgatactgcgacgtgcgggccgcgcaagcg
gcacttcgctcaggtacagcaccaatactgttgggcgcgttgcctttcgacgtgagcaga
cccgccgcattgatggtgccggatggcgtgctgcgggcccggaagctgcctgactggccg
accggcccgctgcccaaggtacgcgtcgccgccgcccttccgccacctgccgactacctg
acccggatcggccgcgcacgggatctgctggccgccttcgacggcccgttgcacaaagtg
gtgctcgcgcgcgccgtgcaactgaccgccgatgctccgctggacgcgcgggtactgttg
cgcaggttggtcgtcgccgacccgaccgcttacggctatctcgtcgacctcacctctgcg
ggcaacgacgacaccggggcagccctggtcggcgccagcccagagcttctggtcgcacga
tccggcaatcgcgtcatgtgcaagccatttgccggctcagccccacgcgccgccgacccc
aaactcgacgccgccaacgcggccgcactagccagttcggccaagaaccgacacgaacac
caattggtcgtcgacacgatgcgggtagccctagagccactatgcgaggacctgacaatc
ccagcccagccccagttgaaccgcaccgcagccgtttggcatctgtgcaccgcgatcacc
ggccggctgcgcaacatctcgacgacggcaatcgatctggctttggcgctacatcccacc
ccggcggttggtggggtcccgacaaaagctgccaccgagctcatcgccgaactcgagggc
gaccgtggcttctacgccggcgcggttggttggtgcgacggccggggcgacggccattgg
gtggtgtctatccggtgcgcgcaactttcggctgatcgacgcgcagcccttgcgcacgct
ggcggtggcatcgtcgccgaatcagaccccgatgacgaacttgaagaaaccacaacgaag
ttcgccacgatattgaccgcactgggagttgagcagtga

DBGET integrated database retrieval system