KEGG   Mycobacterium tuberculosis H37Rv: Rv3227Help
Entry
Rv3227            CDS       T00015                                 

Gene name
aroA
Definition
(RefSeq) 3-phosphoshikimate 1-carboxyvinyltransferase
  KO
K00800  
3-phosphoshikimate 1-carboxyvinyltransferase [EC:2.5.1.19]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rv3227 (aroA)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rv3227 (aroA)
Enzymes [BR:mtu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.19  3-phosphoshikimate 1-carboxyvinyltransferase
     Rv3227 (aroA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
3603377..3604729
Genome map
AA seq 450 aa AA seqDB search
MKTWPAPTAPTPVRATVTVPGSKSQTNRALVLAALAAAQGRGASTISGALRSRDTELMLD
ALQTLGLRVDGVGSELTVSGRIEPGPGARVDCGLAGTVLRFVPPLAALGSVPVTFDGDQQ
ARGRPIAPLLDALRELGVAVDGTGLPFRVRGNGSLAGGTVAIDASASSQFVSGLLLSAAS
FTDGLTVQHTGSSLPSAPHIAMTAAMLRQAGVDIDDSTPNRWQVRPGPVAARRWDIEPDL
TNAVAFLSAAVVSGGTVRITGWPRVSVQPADHILAILRQLNAVVIHADSSLEVRGPTGYD
GFDVDLRAVGELTPSVAALAALASPGSVSRLSGIAHLRGHETDRLAALSTEINRLGGTCR
ETPDGLVITATPLRPGIWRAYADHRMAMAGAIIGLRVAGVEVDDIAATTKTLPEFPRLWA
EMVGPGQGWGYPQPRSGQRARRATGQGSGG
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
gtgaagacatggccagccccaacggcgccgacgccggtgcgcgctaccgtgaccgttcca
ggctcgaagtcgcagaccaaccgggcgctggtgctagcggcgctggcggccgcacaaggc
cggggcgcatcgaccatctccggcgcgctgcgcagccgcgacaccgaactgatgctggac
gcgctgcagaccctgggcctgcgcgtcgacggtgtgggttcggaactgacggtcagcggc
cgaatcgaaccggggcccggcgctcgggtggactgtggcttggcgggcacggtgttgcgg
tttgttccgccgctggcggcgctgggctccgtcccggtcaccttcgacggcgatcagcaa
gcccggggacggcccatcgcaccgctgctggatgcgctgcgcgagctcggcgtcgccgtc
gacggcaccggtctaccgtttcgggttcgcggcaacgggtcgctcgccggcggcaccgtg
gccatcgacgcgtcggcgtcctcacagttcgtgtccgggctgctgctgtccgcggcatcg
ttcaccgatggcctgaccgtccaacacaccggttcgtcgctgccgtctgcgccgcacatc
gcgatgacggcggcgatgctgcggcaagccggagtcgacatcgacgactcgacaccgaac
cgttggcaggtgcgccccggtccggtggcggcgcggcgctgggacatcgaaccggacctg
accaacgcggtggctttcctgtcagcggccgtggtcagcggcggcaccgtgcgcatcacc
ggctggcctagagtcagcgtgcaacccgccgaccacatcttggcaattttgcggcagctc
aatgccgttgtcattcatgctgattcatccctcgaggtgcgcggtccaacgggatacgac
gggtttgacgtcgacttgcgcgccgtcggcgagctgacgccatcggtcgcggcgctggcg
gcgctggcatccccgggatcggtgtccagactaagcggcattgcccatctgcggggccac
gaaaccgaccggctcgccgcgctgagcaccgagatcaaccggttggggggcacctgccgg
gaaacacccgacggtctggtgatcaccgcgacgccgttgcggcccggcatctggcgggca
tacgcggaccatcgaatggcgatggccggcgcgatcattgggctgcgggtggccggagtc
gaggtcgacgacatcgccgccaccaccaagacgctgccggagtttccgcggctgtgggcc
gagatggtcggacccggccaggggtgggggtacccccagccgcgcagcggccagcgggcg
aggcgggcaaccgggcaggggtccggcggttga

DBGET integrated database retrieval system