KEGG   Mycobacterium tuberculosis H37Rv: Rv3247cHelp
Entry
Rv3247c           CDS       T00015                                 

Gene name
tmk
Definition
(RefSeq) thymidylate kinase
  KO
K00943  
dTMP kinase [EC:2.7.4.9]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Rv3247c (tmk)
Enzymes [BR:mtu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.9  dTMP kinase
     Rv3247c (tmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(3627419..3628063)
Genome map
AA seq 214 aa AA seqDB search
MLIAIEGVDGAGKRTLVEKLSGAFRAAGRSVATLAFPRYGQSVAADIAAEALHGEHGDLA
SSVYAMATLFALDRAGAVHTIQGLCRGYDVVILDRYVASNAAYSAARLHENAAGKAAAWV
QRIEFARLGLPKPDWQVLLAVSAELAGERSRGRAQRDPGRARDNYERDAELQQRTGAVYA
ELAAQGWGGRWLVVGADVDPGRLAATLAPPDVPS
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
gtgctaatcgcgattgagggcgttgacggcgctggcaagcggacgttggtggaaaagctg
tccggggcctttcgagcagccgggagatcggtggccacactggcgttcccgcgctacgga
cagtcggtggccgccgacatcgcagcggaggcgctgcacggcgagcacggtgacctcgca
tcgtcggtgtatgcgatggcgacgctgttcgcgctcgaccgcgctggcgcggtccacacg
atccaggggctgtgtcgcggctacgacgtggtgatcctggatcgctacgtcgcctccaac
gcggcctacagcgcggcgcgcctacatgaaaacgcggccgggaaggcagcggcctgggtt
cagcggatcgaatttgcaagactcgggttgcccaagcccgactggcaggtgctccttgcg
gtctctgccgagctcgccggggaacgatcccgcggccgtgcccagcgtgaccccggtcgg
gcgcgcgacaattacgaacgcgacgctgaacttcagcagcgcaccggtgcggtctacgcc
gagttggcggcccaagggtggggcggccggtggctggttgtcggcgccgatgttgatccg
ggccgactagcggcgactttggcgcctccagacgtgccaagttga

DBGET integrated database retrieval system