KEGG   Mycobacterium tuberculosis H37Rv: Rv3255cHelp
Entry
Rv3255c           CDS       T00015                                 

Gene name
manA
Definition
(RefSeq) mannose-6-phosphate isomerase
  KO
K01809  
mannose-6-phosphate isomerase [EC:5.3.1.8]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Fructose and mannose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Rv3255c (manA)
   00520 Amino sugar and nucleotide sugar metabolism
    Rv3255c (manA)
Enzymes [BR:mtu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.8  mannose-6-phosphate isomerase
     Rv3255c (manA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
complement(3635041..3636267)
Genome map
AA seq 408 aa AA seqDB search
MELLRGALRTYAWGSRTAIAEFTGRPVPAAHPEAELWFGAHPGDPAWLQTPHGQTSLLEA
LVADPEGQLGSASRARFGDVLPFLVKVLAADEPLSLQAHPSAEQAVEGYLREERMGIPVS
SPVRNYRDTSHKPELLVALQPFEALAGFREAARTTELLRALAVSDLDPFIDLLSEGSDAD
GLRALFTTWITAPQPDIDVLVPAVLDGAIQYVSSGATEFGAEAKTVLELGERYPGDAGVL
AALLLNRISLAPGEAIFLPAGNLHAYVRGFGVEVMANSDNVLRGGLTPKHVDVPELLRVL
DFAPTPKARLRPPIRREGLGLVFETPTDEFAATLLVLDGDHLGHEVDASSGHDGPQILLC
TEGSATVHGKCGSLTLQRGTAAWVAADDGPIRLTAGQPAKLFRATVGL
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
gtggaactgctacgtggcgcgttacgcacctacgcttggggatcgcgcaccgctatcgcc
gaattcaccgggcgtccggtgccggccgctcaccccgaggccgaactatggttcggtgca
cacccgggtgatccggcttggctgcagacgccgcatggccaaacctcgttgctcgaagcg
ttggtcgcggatccggaggggcagctcggctccgcgtcgcgcgcgcgattcggcgatgtg
ttgccgttcttggtcaaggtgttggcggccgacgagccactatcgttgcaggcccatccg
agcgccgagcaggcggttgagggctacctgcgggaagagcgaatgggcattccggtgtcc
tcacccgtccgcaactaccgcgacaccagtcacaagccagagttattggtggcgctgcag
ccgttcgaggcgctggccggattccgggaggcggctcgcaccaccgagctgctgcgggcg
ctggccgtatccgacctcgacccgttcatcgacttgctgagcgaggggtccgatgccgat
ggtttgcgtgcgctgttcaccacctggattaccgcaccccagcccgacatcgacgtgctg
gtgcctgccgtgctggacggcgctatccagtacgtcagctccggcgcaacggaatttggc
gccgaagccaagacagtgctggaactcggcgaacgttatcccggcgacgccggtgtgctg
gcggcgttgttgctcaaccgcatcagcttggctcctggggaggcgatcttcctgccggcc
ggcaacctgcacgcctatgtgcgtggtttcggtgtggaagtgatggccaactccgacaac
gtgttacgcggtggacttacccctaagcacgtcgatgtgcccgagttgttgcgggtgctg
gacttcgcccccacgccgaaggctcggctgcggcccccgatccggcgcgaggggctgggg
ctggtctttgagacgcccaccgatgagttcgcggccacgctactggtgctcgacggcgat
cacctcggccacgaggtcgacgcgtcgtccggccatgacggtccacagatcttgttatgc
accgagggttcggcgacggtgcacgggaagtgcgggtcgctcacgctacagcgcggcacg
gccgcctgggtggcggccgacgacggcccgatccggctgaccgccggccaacccgccaag
ctgttcagggcgaccgtcgggttgtga

DBGET integrated database retrieval system