KEGG   Mycobacterium tuberculosis H37Rv: Rv3255cHelp
Entry
Rv3255c           CDS       T00015                                 

Gene name
manA
Definition
(RefSeq) mannose-6-phosphate isomerase
  KO
K01809  mannose-6-phosphate isomerase [EC:5.3.1.8]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00051  Fructose and mannose metabolism
mtu00520  Amino sugar and nucleotide sugar metabolism
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Rv3255c (manA)
   00520 Amino sugar and nucleotide sugar metabolism
    Rv3255c (manA)
Enzymes [BR:mtu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.8  mannose-6-phosphate isomerase
     Rv3255c (manA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PMI_typeI
Motif
Other DBs
NCBI-GeneID: 888698
NCBI-ProteinID: NP_217772
TubercuList: Rv3255c
UniProt: A0A089QX71 O05898
Position
complement(3635041..3636267)
Genome map
AA seq 408 aa AA seqDB search
MELLRGALRTYAWGSRTAIAEFTGRPVPAAHPEAELWFGAHPGDPAWLQTPHGQTSLLEA
LVADPEGQLGSASRARFGDVLPFLVKVLAADEPLSLQAHPSAEQAVEGYLREERMGIPVS
SPVRNYRDTSHKPELLVALQPFEALAGFREAARTTELLRALAVSDLDPFIDLLSEGSDAD
GLRALFTTWITAPQPDIDVLVPAVLDGAIQYVSSGATEFGAEAKTVLELGERYPGDAGVL
AALLLNRISLAPGEAIFLPAGNLHAYVRGFGVEVMANSDNVLRGGLTPKHVDVPELLRVL
DFAPTPKARLRPPIRREGLGLVFETPTDEFAATLLVLDGDHLGHEVDASSGHDGPQILLC
TEGSATVHGKCGSLTLQRGTAAWVAADDGPIRLTAGQPAKLFRATVGL
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
gtggaactgctacgtggcgcgttacgcacctacgcttggggatcgcgcaccgctatcgcc
gaattcaccgggcgtccggtgccggccgctcaccccgaggccgaactatggttcggtgca
cacccgggtgatccggcttggctgcagacgccgcatggccaaacctcgttgctcgaagcg
ttggtcgcggatccggaggggcagctcggctccgcgtcgcgcgcgcgattcggcgatgtg
ttgccgttcttggtcaaggtgttggcggccgacgagccactatcgttgcaggcccatccg
agcgccgagcaggcggttgagggctacctgcgggaagagcgaatgggcattccggtgtcc
tcacccgtccgcaactaccgcgacaccagtcacaagccagagttattggtggcgctgcag
ccgttcgaggcgctggccggattccgggaggcggctcgcaccaccgagctgctgcgggcg
ctggccgtatccgacctcgacccgttcatcgacttgctgagcgaggggtccgatgccgat
ggtttgcgtgcgctgttcaccacctggattaccgcaccccagcccgacatcgacgtgctg
gtgcctgccgtgctggacggcgctatccagtacgtcagctccggcgcaacggaatttggc
gccgaagccaagacagtgctggaactcggcgaacgttatcccggcgacgccggtgtgctg
gcggcgttgttgctcaaccgcatcagcttggctcctggggaggcgatcttcctgccggcc
ggcaacctgcacgcctatgtgcgtggtttcggtgtggaagtgatggccaactccgacaac
gtgttacgcggtggacttacccctaagcacgtcgatgtgcccgagttgttgcgggtgctg
gacttcgcccccacgccgaaggctcggctgcggcccccgatccggcgcgaggggctgggg
ctggtctttgagacgcccaccgatgagttcgcggccacgctactggtgctcgacggcgat
cacctcggccacgaggtcgacgcgtcgtccggccatgacggtccacagatcttgttatgc
accgagggttcggcgacggtgcacgggaagtgcgggtcgctcacgctacagcgcggcacg
gccgcctgggtggcggccgacgacggcccgatccggctgaccgccggccaacccgccaag
ctgttcagggcgaccgtcgggttgtga

DBGET integrated database retrieval system