KEGG   Mycobacterium tuberculosis H37Rv: Rv3257cHelp
Entry
Rv3257c           CDS       T00015                                 

Gene name
pmmA
Definition
(RefSeq) phosphomannomutase PmmA
  KO
K01840  
phosphomannomutase [EC:5.4.2.8]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Fructose and mannose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mtu00001]
   00051 Fructose and mannose metabolism
    Rv3257c (pmmA)
   00520 Amino sugar and nucleotide sugar metabolism
    Rv3257c (pmmA)
Enzymes [BR:mtu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.8  phosphomannomutase
     Rv3257c (pmmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
complement(3637312..3638709)
Genome map
AA seq 465 aa AA seqDB search
MSWPAAAVDRVIKAYDVRGLVGEEIDESLVTDLGAAFARLMRTEDARPVVIGHDMRDSSP
SLADAFAAGVTGQGLDVVRVGLASTDQLYFASGLLDCPGAMFTASHNPAAYNGIKMCRAA
AKPVGADTGLTAIRDDLIAGVARYDGTPGTIADQDVLVDYGAFLRSLVDTSGLRPLRVAV
DAGNGMAGHTAPAVLGVIDSITLLPSYFELDGSFPNHEANPLDPANLVDLQAYVRDTGAD
IGLAFDGDADRCFVVDERGQPVSPSTVTALVAARELNREIGATIIHNVITSRAVPELVAE
RGGTPLRSRVGHSYIKALMAETGAIFGGEHSAHYYFRDFWGADSGMLAALHVLAALGEQS
RPLSELTADYQRYESSGEINFTVVDSSACVEAVLKSFGNRIVSIDHLDGVTVDLGDDSWF
NLRSSNTEPLLRLNVEGRSVGDVDAVVRQVSAEIAAQSAHAKAGP
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgtcttggcccgccgcggctgtggaccgcgttatcaaggcttacgacgtacgcgggctg
gtcggcgaagagatcgacgagtcgctggttaccgatctcggcgccgcattcgcgcggttg
atgcggaccgaggatgcgcgaccagtggtgatcggtcacgacatgcgggacagttcgccg
tcgctggccgacgcgttcgcggccggggtgaccgggcagggcctcgacgtggtgcgagtt
ggtttggcgtccaccgatcagctttatttcgcctcggggctgttggactgcccgggagcg
atgttcaccgcgagccacaacccggcggcatacaacggcatcaagatgtgtcgggccgcc
gccaaaccagtcggagccgataccgggctgaccgccatccgtgacgacctgatcgccggc
gtcgcacgatacgacgggacgcccggaaccattgccgaccaggacgtgctggtcgactac
ggggcgttcctgcgatcgctggtggacacctcggggctacgtccgttgcgggtggccgtg
gacgccggcaacggcatggccggtcacaccgcgccggcggtccttggggtgatcgactcg
atcaccttgttgccctcgtattttgagctcgacggatcgtttcccaatcacgaggccaat
ccgctggacccggcgaacctggtggatctgcaggcctatgtgcgtgacaccggcgccgat
atcgggcttgctttcgacggcgacgccgaccgctgcttcgtggtcgacgaacgcggccag
ccggtctcgccgtcgacggttaccgcattggtggccgcgcgggaactcaaccgggagatc
ggcgccaccatcatccacaacgtgatcacctcccgcgcggtgcccgagctggtcgccgag
cgcggcggtacgccgctgcgttcgcgggttgggcactcctatatcaaggcactgatggcc
gagaccggggcgattttcggtggtgaacattcggcgcactattacttccgtgacttctgg
ggtgccgattccggaatgctggccgcactgcatgtgctggccgccctcggtgagcagagc
agaccgctgtcggagttgaccgcggactaccaacgctatgaatcctccggcgagatcaac
ttcaccgtggtcgactcttcggcctgtgtggaggccgtgttgaaatcgttcggcaaccgg
attgtcagtattgatcacctcgatggcgtgaccgttgacttaggcgacgacagctggttc
aacctgcgcagctcaaacaccgagccgttgctgcggctcaatgtggagggccgcagcgtc
ggggacgttgacgcggtggtacgtcaggtcagcgctgaaatcgctgcccagagcgcacat
gcgaaggccggaccgtga

DBGET integrated database retrieval system