KEGG   Mycobacterium tuberculosis H37Rv: Rv3257cHelp
Entry
Rv3257c           CDS       T00015                                 

Gene name
pmmA
Definition
(RefSeq) phosphomannomutase PmmA
  KO
K01840  phosphomannomutase [EC:5.4.2.8]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00051  Fructose and mannose metabolism
mtu00520  Amino sugar and nucleotide sugar metabolism
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Rv3257c (pmmA)
   00520 Amino sugar and nucleotide sugar metabolism
    Rv3257c (pmmA)
Enzymes [BR:mtu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.8  phosphomannomutase
     Rv3257c (pmmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_III PGM_PMM_II PGM_PMM_IV
Motif
Other DBs
NCBI-GeneID: 888699
NCBI-ProteinID: NP_217774
TubercuList: Rv3257c
UniProt: O86374 L0TDM0
Position
complement(3637312..3638709)
Genome map
AA seq 465 aa AA seqDB search
MSWPAAAVDRVIKAYDVRGLVGEEIDESLVTDLGAAFARLMRTEDARPVVIGHDMRDSSP
SLADAFAAGVTGQGLDVVRVGLASTDQLYFASGLLDCPGAMFTASHNPAAYNGIKMCRAA
AKPVGADTGLTAIRDDLIAGVARYDGTPGTIADQDVLVDYGAFLRSLVDTSGLRPLRVAV
DAGNGMAGHTAPAVLGVIDSITLLPSYFELDGSFPNHEANPLDPANLVDLQAYVRDTGAD
IGLAFDGDADRCFVVDERGQPVSPSTVTALVAARELNREIGATIIHNVITSRAVPELVAE
RGGTPLRSRVGHSYIKALMAETGAIFGGEHSAHYYFRDFWGADSGMLAALHVLAALGEQS
RPLSELTADYQRYESSGEINFTVVDSSACVEAVLKSFGNRIVSIDHLDGVTVDLGDDSWF
NLRSSNTEPLLRLNVEGRSVGDVDAVVRQVSAEIAAQSAHAKAGP
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgtcttggcccgccgcggctgtggaccgcgttatcaaggcttacgacgtacgcgggctg
gtcggcgaagagatcgacgagtcgctggttaccgatctcggcgccgcattcgcgcggttg
atgcggaccgaggatgcgcgaccagtggtgatcggtcacgacatgcgggacagttcgccg
tcgctggccgacgcgttcgcggccggggtgaccgggcagggcctcgacgtggtgcgagtt
ggtttggcgtccaccgatcagctttatttcgcctcggggctgttggactgcccgggagcg
atgttcaccgcgagccacaacccggcggcatacaacggcatcaagatgtgtcgggccgcc
gccaaaccagtcggagccgataccgggctgaccgccatccgtgacgacctgatcgccggc
gtcgcacgatacgacgggacgcccggaaccattgccgaccaggacgtgctggtcgactac
ggggcgttcctgcgatcgctggtggacacctcggggctacgtccgttgcgggtggccgtg
gacgccggcaacggcatggccggtcacaccgcgccggcggtccttggggtgatcgactcg
atcaccttgttgccctcgtattttgagctcgacggatcgtttcccaatcacgaggccaat
ccgctggacccggcgaacctggtggatctgcaggcctatgtgcgtgacaccggcgccgat
atcgggcttgctttcgacggcgacgccgaccgctgcttcgtggtcgacgaacgcggccag
ccggtctcgccgtcgacggttaccgcattggtggccgcgcgggaactcaaccgggagatc
ggcgccaccatcatccacaacgtgatcacctcccgcgcggtgcccgagctggtcgccgag
cgcggcggtacgccgctgcgttcgcgggttgggcactcctatatcaaggcactgatggcc
gagaccggggcgattttcggtggtgaacattcggcgcactattacttccgtgacttctgg
ggtgccgattccggaatgctggccgcactgcatgtgctggccgccctcggtgagcagagc
agaccgctgtcggagttgaccgcggactaccaacgctatgaatcctccggcgagatcaac
ttcaccgtggtcgactcttcggcctgtgtggaggccgtgttgaaatcgttcggcaaccgg
attgtcagtattgatcacctcgatggcgtgaccgttgacttaggcgacgacagctggttc
aacctgcgcagctcaaacaccgagccgttgctgcggctcaatgtggagggccgcagcgtc
ggggacgttgacgcggtggtacgtcaggtcagcgctgaaatcgctgcccagagcgcacat
gcgaaggccggaccgtga

DBGET integrated database retrieval system