KEGG   Mycobacterium tuberculosis H37Rv: Rv3260cHelp
Entry
Rv3260c           CDS       T00015                                 

Gene name
whiB2
Definition
(RefSeq) transcriptional regulator WhiB2
  KO
K18955  
WhiB family transcriptional regulator, redox-sensing transcriptional regulator
Organism
mtu  Mycobacterium tuberculosis H37Rv
Brite
Transcription factors [BR:mtu03000]
 Prokaryotic Type
  Other transcription factors
   Others
    Rv3260c (whiB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Position
complement(3639872..3640141)
Genome map
AA seq 89 aa AA seqDB search
MVPEAPAPFEEPLPPEATDQWQDRALCAQTDPEAFFPEKGGSTREAKKICMGCEVRHECL
EYALAHDERFGIWGGLSERERRRLKRGII
NT seq 270 nt NT seq  +upstreamnt  +downstreamnt
ttggttcccgaggcgccggcgccattcgaggaacctctgccgccggaagccaccgaccaa
tggcaggaccgtgcgctatgtgcgcaaacggatcccgaagcgttcttcccggagaagggc
ggctccacgcgtgaggccaagaagatttgcatgggctgcgaggtgcggcacgagtgtctg
gagtacgccctggctcatgacgagcggttcggcatctggggtggtctttccgaacgcgag
cgccgccgcctcaaacgcgggatcatctga

DBGET integrated database retrieval system