KEGG   Mycobacterium tuberculosis H37Rv: Rv3261Help
Entry
Rv3261            CDS       T00015                                 

Gene name
fbiA
Definition
(RefSeq) 2-phospho-L-lactate transferase
  KO
K11212  
LPPG:FO 2-phospho-L-lactate transferase [EC:2.7.8.28]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Methane metabolism
Microbial metabolism in diverse environments
Module
F420 biosynthesis
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    Rv3261 (fbiA)
Enzymes [BR:mtu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.28  2-phospho-L-lactate transferase
     Rv3261 (fbiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
3640543..3641538
Genome map
AA seq 331 aa AA seqDB search
MKVTVLAGGVGGARFLLGVQQLLGLGQFAANSAHSDADHQLSAVVNVGDDAWIHGLRVCP
DLDTCMYTLGGGVDPQRGWGQRDETWHAMQELVRYGVQPDWFELGDRDLATHLVRTQMLQ
AGYPLSQITEALCDRWQPGARLLPATDDRCETHVVITDPVDESRKAIHFQEWWVRYRAQV
PTHSFAFVGAEKSSAATEAIAALADADIIMLAPSNPVVSIGAILAVPGIRAALREATAPI
VGYSPIIGEKPLRGMADTCLSVIGVDSTAAAVGRHYGARCATGILDCWLVHDGDHAEIDG
VTVRSVPLLMTDPNATAEMVRAGCDLAGVVA
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggtcaccgttctggccggtggagtcggcggcgcccgcttcctgctcggggtccag
cagctgctcggcctgggccagtttgctgccaattctgcccactcggacgccgaccaccaa
ctgagcgctgtcgtcaacgtcggcgacgacgcctggatccacgggctgcgtgtctgcccg
gatctggacacctgcatgtataccctgggcggcggggtggacccccagcgcggctggggc
cagcgtgacgaaacttggcacgccatgcaggaactggtgcgctatggcgtgcagcccgac
tggttcgagctcggggaccgcgatctggccacccatctggtgcgcacccagatgctgcag
gccggctaccccctgtcacagatcaccgaggccctatgcgatcgctggcaaccgggcgcc
cgcttgctgcctgccaccgacgaccgttgcgaaacccatgtagtgatcaccgacccggtc
gacgaaagccgcaaggcgatccattttcaggagtggtgggtgcgctaccgtgcccaggtg
ccgacgcacagctttgcttttgtcggcgctgaaaagtccagcgctgcaaccgaagcgatc
gccgccctggccgacgccgacatcatcatgctggcgccgtctaatccggtggtcagcatc
ggcgccatcctggccgtccccgggattcgcgcggcgttgcgggaagcaaccgcaccgatc
gtcggctactcgccgatcatcggcgaaaagccgttgcgcggcatggccgatacgtgcctt
tcggttatcggggtggattccaccgcggccgctgtgggccggcactacggcgcgcggtgc
gccaccgggatactggactgctggctggtgcacgacggcgaccacgctgagattgacggg
gtgacggtgcggtcggtgccgctgctgatgaccgacccgaacgcgacggctgagatggtt
cgcgccgggtgcgaccttgcgggagtggtagcttga

DBGET integrated database retrieval system