KEGG   Mycobacterium tuberculosis H37Rv: Rv3265cHelp
Entry
Rv3265c           CDS       T00015                                 

Gene name
wbbL1
Definition
(RefSeq) N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase
  KO
K16870  
N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase [EC:2.4.1.289]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Brite
Enzymes [BR:mtu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.289  N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase
     Rv3265c (wbbL1)
Glycosyltransferases [BR:mtu01003]
 Polysaccharide
  Bacterial polysaccharide
   Rv3265c (wbbL1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Position
complement(3645979..3646884)
Genome map
AA seq 301 aa AA seqDB search
MVAVTYSPGPHLERFLASLSLATERPVSVLLADNGSTDGTPQAAVQRYPNVRLLPTGANL
GYGTAVNRTIAQLGEMAGDAGEPWVDDWVIVANPDVQWGPGSIDALLDAASRWPRAGALG
PLIRDPDGSVYPSARQMPSLIRGGMHAVLGPFWPRNPWTTAYRQERLEPSERPVGWLSGS
CLLVRRSAFGQVGGFDERYFMYMEDVDLGDRLGKAGWLSVYVPSAEVLHHKAHSTGRDPA
SHLAAHHKSTYIFLADRHSGWWRAPLRWTLRGSLALRSHLMVRSSLRRSRRRKLKLVEGR
H
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
gtggtagcggtgacctactcgccggggccccatctagagcggttcctggcgtcgttgtcg
ctggccaccgagcggccggtcagcgtgctgttggcagacaacggctccaccgacggcacc
ccgcaggccgcggtgcagcgctaccccaacgtgcggctgctgcccacaggggccaacctc
gggtacggaaccgcggtgaatcggacgatcgcccagctcggtgaaatggcgggcgatgcc
ggcgaaccctgggtcgatgactgggtgatcgtggccaacccggacgtgcaatggggcccg
ggcagtatcgatgcactactggacgccgcctcccgctggccccgcgcgggcgcgctgggc
ccgctgattcgggaccccgacgggtcggtgtacccgtcggcgcggcagatgcccagcctg
atccgcggcggcatgcacgcagtgctcgggccgttctggccgcgcaatccgtggacgacg
gcctaccggcaggagcggctggagcccagtgaacggccggtgggttggttgtcggggtct
tgcctactggtgcgccggtcggcgtttggccaggtcggcggattcgacgaacgttacttc
atgtacatggaggacgtcgaccttggcgaccggcttggcaaagccggttggctgtcggtg
tatgtgccgtcagccgaggttctgcaccacaaggcgcattcgacgggtcgcgacccggca
agccatctggccgcccatcacaaaagcacctatatcttcttagccgaccgacattctggt
tggtggcgggctccgctgcgctggaccctgcggggatcactggcgctgcgttcccacctc
atggtgcgcagttcactgcgcaggtcccgcagacggaaactgaagctggtagaagggcgg
cactga

DBGET integrated database retrieval system