KEGG   Mycobacterium tuberculosis H37Rv: Rv3266cHelp
Entry
Rv3266c           CDS       T00015                                 

Gene name
rmlD
Definition
(RefSeq) dTDP-4-dehydrorhamnose reductase
  KO
K00067  
dTDP-4-dehydrorhamnose reductase [EC:1.1.1.133]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Biosynthesis of antibiotics
Module
dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Rv3266c (rmlD)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Rv3266c (rmlD)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.133  dTDP-4-dehydrorhamnose reductase
     Rv3266c (rmlD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
complement(3646895..3647809)
Genome map
AA seq 304 aa AA seqDB search
MAGRSERLVITGAGGQLGSHLTAQAAREGRDMLALTSSQWDITDPAAAERIIRHGDVVIN
CAAYTDVDGAESNEAVAYAVNATGPQHLARACARVGARLIHVSTDYVFDGDFGGAEPRPY
EPTDETAPQGVYARSKLAGEQAVLAAFPEAAVVRTAWVYTGGTGKDFVAVMRRLAAGHGR
VDVVDDQTGSPTYVADLAEALLALADAGVRGRVLHAANEGVVSRFGQARAVFEECGADPQ
RVRPVSSAQFPRPAPRSSYSALSSRQWALAGLTPLRHWRSALATALAAPANSTSIDRRLP
STRD
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcaggtcagaaaggctagtcatcaccggtgcgggcgggcagctgggcagccat
ctgacggcacaggccgcccgggaaggccgcgatatgctggcgctgacttcctcgcagtgg
gatatcaccgaccccgctgcggccgagcggatcatccgacacggtgacgtggtgatcaat
tgcgccgcctacaccgacgtcgacggcgccgagagcaatgaggcagtcgcctatgcggtc
aatgccactggcccgcaacacctcgcccgtgcgtgcgctcgtgtgggtgctcggttaatc
cacgtctccaccgactacgtattcgatggcgacttcggcggcgccgagccccggccctac
gagcccaccgatgaaaccgcgccgcagggcgtgtatgcccgcagcaaactcgccggcgag
caggctgtgctggcagcgttcccggaggctgccgtggtacggaccgcctgggtctacacc
ggcgggaccggcaaggatttcgtcgccgtcatgcgccggctggccgccggacacggtcgg
gtggatgtggtcgacgaccagaccgggtcgccgacctacgtcgccgacctggccgaggcg
ctgctggcgttggccgacgcgggcgtgcgcggacgcgtgttgcacgccgctaacgagggc
gtggtctcccggttcggtcaagcccgcgcggtgttcgaagaatgcggtgccgacccacag
cgggtgcgtccggtcagcagcgcgcagtttccgcggcccgcgccgcgttcgagctattcc
gcgctgtcgagcaggcagtgggcgctggcgggcttgacgccgctacggcactggcgcagc
gcactggccacggcgctggcagcacctgcgaactcaacttcgatcgatcgacggttaccc
tcaacgcgtgactga

DBGET integrated database retrieval system