KEGG   Mycobacterium tuberculosis H37Rv: Rv3279cHelp
Entry
Rv3279c           CDS       T00015                                 

Gene name
birA
Definition
(RefSeq) bifunctional biotin operon repressor/biotin--[acetyl-CoA-carboxylase] synthetase
  KO
K03524  
BirA family transcriptional regulator, biotin operon repressor / biotin---[acetyl-CoA-carboxylase] ligase [EC:6.3.4.15]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Biotin metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Rv3279c (birA)
Enzymes [BR:mtu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.15  biotin---[acetyl-CoA-carboxylase] ligase
     Rv3279c (birA)
Transcription factors [BR:mtu03000]
 Prokaryotic Type
  Helix-turn-helix
   Other families
    Rv3279c (birA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(3661212..3662012)
Genome map
AA seq 266 aa AA seqDB search
MTDRDRLRPPLDERSLRDQLIGAGSGWRQLDVVAQTGSTNADLLARAASGADIDGVVLIA
EHQTAGRGRHGRGWAATARAQIILSVGVRVVDVPVQAWGWLSLAAGLAVLDSVAPLIAVP
PAETGLKWPNDVLARGGKLAGILAEVAQPFVVLGVGLNVTQAPEEVDPDATSLLDLGVAA
PDRNRIASRLLRELEARIIQWRNANPQLAADYRARSLTIGSRVRVELPGGQDVVGIARDI
DDQGRLCLDVGGRTVVVSAGDVVHLR
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgaccgcgatcggctcaggccgcctttggacgaacgctcactgcgcgaccagctg
atcggtgctggatccgggtggcgccaacttgacgtcgtggcccaaaccggttccaccaac
gccgacttgctggcccgggcggcatccggggccgatatcgacggggtggtgttgatcgcc
gagcatcagaccgctgggcgggggcgtcatggccgcggctgggcggccactgcccgagcg
cagatcatcctgtcggtcggtgtgcgtgtggtcgacgtcccggtgcaagcgtggggctgg
ctgtcactggccgcgggtctggcggtgctcgattcggtggcccccctgattgcagtcccg
ccggccgaaacgggcctcaagtggcccaatgacgtgctggcccggggtggcaagttagcc
ggcatcctggccgaggtcgcgcagccgtttgtggtactcggtgtgggactcaacgtcacc
caggcccccgaagaggttgatcccgacgcgacctcattgctggacctcggagtggcggca
ccggaccgcaaccgcatagccagcaggctgttgcgcgagctcgaagctcggatcatccag
tggcgcaacgccaacccacaactggcggccgactaccgtgctcgcagcctgaccattggg
tcgcgcgtgcgcgtcgagctccccggtggccaggacgtcgtcgggatcgcgcgtgacatc
gatgaccagggtcggctgtgtctggacgtcggcggtcgaacggtagttgtttcagcgggc
gacgtggtgcatttgcgttaa

DBGET integrated database retrieval system