KEGG   Mycobacterium tuberculosis H37Rv: Rv3280Help
Entry
Rv3280            CDS       T00015                                 

Gene name
accD5
Definition
(RefSeq) propionyl-CoA carboxylase subunit beta
  KO
K01966  
propionyl-CoA carboxylase beta chain [EC:6.4.1.3]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Valine, leucine and isoleucine degradation
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rv3280 (accD5)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Rv3280 (accD5)
   00640 Propanoate metabolism
    Rv3280 (accD5)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Rv3280 (accD5)
Enzymes [BR:mtu01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.3  propionyl-CoA carboxylase
     Rv3280 (accD5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
3662062..3663708
Genome map
AA seq 548 aa AA seqDB search
MTSVTDRSAHSAERSTEHTIDIHTTAGKLAELHKRREESLHPVGEDAVEKVHAKGKLTAR
ERIYALLDEDSFVELDALAKHRSTNFNLGEKRPLGDGVVTGYGTIDGRDVCIFSQDATVF
GGSLGEVYGEKIVKVQELAIKTGRPLIGINDGAGARIQEGVVSLGLYSRIFRNNILASGV
IPQISLIMGAAAGGHVYSPALTDFVIMVDQTSQMFITGPDVIKTVTGEEVTMEELGGAHT
HMAKSGTAHYAASGEQDAFDYVRELLSYLPPNNSTDAPRYQAAAPTGPIEENLTDEDLEL
DTLIPDSPNQPYDMHEVITRLLDDEFLEIQAGYAQNIVVGFGRIDGRPVGIVANQPTHFA
GCLDINASEKAARFVRTCDCFNIPIVMLVDVPGFLPGTDQEYNGIIRRGAKLLYAYGEAT
VPKITVITRKAYGGAYCVMGSKDMGCDVNLAWPTAQIAVMGASGAVGFVYRQQLAEAAAN
GEDIDKLRLRLQQEYEDTLVNPYVAAERGYVDAVIPPSHTRGYIGTALRLLERKIAQLPP
KKHGNVPL
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgacaagcgttaccgaccgctcggctcattccgcagagcggtccaccgagcacaccatc
gacatccacaccaccgcgggcaagctggcggagctgcacaaacgcagggaagagtcgctg
caccccgtcggtgaggatgccgtcgaaaaagtacacgccaagggcaagctgacggctcgc
gagcgtatctacgcgttgctggatgaggattcgttcgtcgagctggacgcgctggccaaa
caccgcagcaccaacttcaatctcggtgaaaaacgcccgctcggcgacggcgtggtcacc
ggctacggcaccatcgacgggcgcgacgtgtgcatcttcagccaggacgccacggtgttt
ggcggcagccttggcgaggtgtacggcgagaaaatcgtcaaggtccaggaactggcgatc
aagaccggccgtccgctcatcggcatcaacgacggtgctggcgcgcgcatccaggaaggt
gtcgtctcgctgggcctgtacagccgtatctttcgcaacaacatcctggcctccggcgtc
atcccgcaaatctcgttgatcatgggagccgccgccggtgggcacgtctactcccccgcc
ctgaccgacttcgtgatcatggtcgatcagaccagccagatgttcatcaccgggcccgac
gtcatcaagaccgtcaccggcgaggaagtcaccatggaagaactcggcggcgcccacacc
cacatggccaagtcgggtacggcacactacgccgcatcgggcgaacaggacgccttcgac
tacgttcgcgagctgctgagctacctgccgcccaacaactccaccgacgcgccccgatac
caagccgcagccccgacagggcccatcgaggagaacctcaccgacgaggacctcgaattg
gatacgctgatcccggactcgcccaaccagccctatgacatgcacgaggtgatcacccgg
ctcctcgacgacgaattcctggagatacaggccggttacgcccaaaacatcgtggtgggg
ttcgggcgcatcgacggccggccagtcggcattgtcgccaaccagccgacacacttcgcc
ggctgcctggatatcaacgcctcggagaaagcggcccggtttgtgcggacctgcgactgc
ttcaatatccccatcgtcatgctggtggacgtcccgggcttcctgccgggcaccgaccag
gaatacaacggcatcatccggcgcggcgccaagctgctctacgcctacggcgaggccacc
gtgccaaagatcacggtcatcacccgcaaggcctacggcggtgcgtactgcgttatgggc
tccaaagacatgggctgcgacgtcaacctggcgtggccgaccgcgcagatcgcggtgatg
ggcgcctccggcgcagtgggcttcgtgtaccgccagcagctggccgaggccgccgccaac
ggcgaggacatcgacaagctgcggctgcggctccagcaggagtacgaggacacactggtc
aacccgtacgtggccgccgaacgcggatacgtcgacgcggtgatcccgccgtcgcatact
cgcggctacatcgggaccgcgctgcggctgctggaacgcaagatcgcgcagctgccgccc
aaaaagcatgggaacgtgcccctgtga

DBGET integrated database retrieval system