KEGG   Mycobacterium tuberculosis H37Rv: Rv3302cHelp
Entry
Rv3302c           CDS       T00015                                 

Gene name
glpD2
Definition
(RefSeq) glycerol-3-phosphate dehydrogenase
  KO
K00111  
glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Glycerophospholipid metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Rv3302c (glpD2)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Rv3302c (glpD2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Position
complement(3687685..3689442)
Genome map
AA seq 585 aa AA seqDB search
MSNPIQAPDGGQGWPAAALGPAQRAVAWKRLGTEQFDVVVIGGGVVGSGCALDAATRGLK
VALVEARDLASGTSSRSSKMFHGGLRYLEQLEFGLVREALYERELSLTTLAPHLVKPLPF
LFPLTKRWWERPYIAAGIFLYDRLGGAKSVPAQRHFTRAGALRLSPGLKRSSLIGGIRYY
DTVVDDARHTMTVARTAAHYGAVVRCSTQVVALLREGDRVIGVGVRDSENGAVAEVRGHV
VVNATGVWTDEIQALSKQRGRFQVRASKGVHVVVPRDRIVSDVAMILRTEKSVMFVIPWG
SHWIIGTTDTDWNLDLAHPAATKADIDYILGTVNAVLATPLTHADIDGVYAGLRPLLAGE
SDDTSKLSREHAVAVPAAGLVAIAGGKYTTYRVMAADAIDAAVQFIPARVAPSITEKVSL
LGADGYFALVNQAEHVGALQGLHPYRVRHLLDRYGSLISDVLAMAASDPSLLSPITEAPG
YLKVEAAYAAAAEGALHLEDILARRMRISIEYPHRGVDCAREVAEVVAPVLGWTAADIDR
EVANYMARVEAEVLSQAQPDDVSADMLRASAPEARAEILEPVPLD
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaacccaatccaggcaccggacggcgggcaggggtggcccgccgcggcgctggga
cctgcacagcgcgcggtcgcctggaagcgactcggaaccgagcaattcgacgtcgtggtg
atcggcggcggagtagtgggctccggatgcgctttggatgctgccacccgtgggctcaag
gtggcgttggtcgaggcgcgggacttggcctccggcacgtcgagccgctcctcgaagatg
ttccacggcgggctgcgctacctcgagcaactggagttcgggctggtgcgtgaggcgctc
tatgaacgtgaactgtcgctgaccacgctggcaccgcatttggtcaagccgctgccgttt
ttgttcccgctgaccaaacgctggtgggagcgtccctacatcgccgcgggtatctttctt
tacgaccggctgggtggcgcgaaatcggttccggcgcaacggcattttactcgcgccggt
gcgctgcgactgagccccggcttgaagcgcagctcgctgatcggtggtatccgttactac
gacaccgtcgtcgacgacgcccggcacaccatgacggtcgcgcgcaccgcggcgcattac
ggcgcggttgtccgctgctccacccaggtagtggccttgttgcgagagggtgaccgggtg
atcggcgtgggcgtccgcgactccgagaacggcgcggttgccgaggttcgcggccacgtc
gtggtcaacgcgaccggggtctggaccgatgagattcaagcgttgtccaaacagcgcggg
cgcttccaggtgcgcgcatccaagggcgtgcatgtggtggtgccgcgggaccggattgtc
agtgacgtcgcgatgatcctgcgcacggagaagtcggtgatgtttgtcattccgtgggga
agtcactggatcatcggaaccaccgataccgactggaacctcgacctggcgcaccccgcg
gccaccaaggccgacatcgactacatcctgggcactgtcaacgccgtgttggcgaccccg
ttgacgcacgccgacattgacggagtgtacgccgggctgcggccgctgcttgccggggaa
agcgacgacacctccaagctgtcccgggaacacgccgtggctgtgccggcggcgggcctg
gtggccatcgccggtggcaagtacaccacctaccgagtaatggcggccgacgcgatcgac
gctgctgtgcagttcatccccgcccgcgttgcgccgtcgatcaccgagaaggtcagcctg
ctgggcgccgacggttactttgcactggtcaatcaggccgaacacgtcggcgcgctgcag
ggcctgcacccgtaccgggtgcgccatctgctggaccgctatggttcgctgatcagcgac
gttctagcgatggcggcctccgatcccagcctgttgagcccgataacggaggcaccgggc
tatttgaaggtggaagccgcttacgccgccgccgccgagggcgccctgcatctcgaggac
atcctggcccgtcggatgcggatttccatcgaatacccgcaccggggcgtcgactgcgcc
cgggaggtggccgaggtggtcgcgcccgtgctcgggtggaccgccgcagacatcgaccgc
gaggtcgcgaactatatggcgcgcgtggaggccgaggtgctctcccaggcccagcccgac
gacgtttcggcggacatgttgcgggccagcgcacccgaggcgcgtgccgagatcctcgag
ccggtgcctttggattga

DBGET integrated database retrieval system