KEGG   Mycobacterium tuberculosis H37Rv: Rv3303cHelp
Entry
Rv3303c           CDS       T00015                                 

Gene name
lpdA
Definition
(RefSeq) NAD(P)H quinone reductase LpdA
  KO
K00382  
dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Glycine, serine and threonine metabolism
Valine, leucine and isoleucine degradation
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rv3303c (lpdA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rv3303c (lpdA)
   00020 Citrate cycle (TCA cycle)
    Rv3303c (lpdA)
   00620 Pyruvate metabolism
    Rv3303c (lpdA)
   00630 Glyoxylate and dicarboxylate metabolism
    Rv3303c (lpdA)
   00640 Propanoate metabolism
    Rv3303c (lpdA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rv3303c (lpdA)
   00280 Valine, leucine and isoleucine degradation
    Rv3303c (lpdA)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     Rv3303c (lpdA)
Exosome [BR:mtu04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Rv3303c (lpdA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(3689457..3690938)
Genome map
AA seq 493 aa AA seqDB search
MVTRIVILGGGPAGYEAALVAATSHPETTQVTVIDCDGIGGAAVLDDCVPSKTFIASTGL
RTELRRAPHLGFHIDFDDAKISLPQIHARVKTLAAAQSADITAQLLSMGVQVIAGRGELI
DSTPGLARHRIKATAADGSTSEHEADVVLVATGASPRILPSAQPDGERILTWRQLYDLDA
LPDHLIVVGSGVTGAEFVDAYTELGVPVTVVASQDHVLPYEDADAALVLEESFAERGVRL
FKNARAASVTRTGAGVLVTMTDGRTVEGSHALMTIGSVPNTSGLGLERVGIQLGRGNYLT
VDRVSRTLATGIYAAGDCTGLLPLASVAAMQGRIAMYHALGEGVSPIRLRTVAATVFTRP
EIAAVGVPQSVIDAGSVAARTIMLPLRTNARAKMSEMRHGFVKIFCRRSTGVVIGGVVVA
PIASELILPIAVAVQNRITVNELAQTLAVYPSLSGSITEAARRLMAHDDLDCTAAQDAAE
QLALVPHHLPTSN
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
gtggtgacccgcatcgtgatcctcggtggcggcccggccggttacgaggccgcactggtg
gccgccacctcacacccggaaacaacccaagttaccgtgattgactgcgacggcatcggc
ggggctgccgtactggacgactgtgtgccgtcgaagacgttcatcgcctccaccgggctg
cgtaccgaactgcgccgagcgccgcacctgggctttcatatcgacttcgacgacgccaag
atctcgttgccgcaaatccatgcccgggtcaagacgctggccgccgcacagtcggccgac
atcaccgcccagctgctcagcatgggggttcaggtgatcgccggccggggcgagttgatc
gactccacaccgggtctggcgcgccatcgcattaaggcgaccgccgccgacggctccacc
agtgagcatgaggccgacgtcgtgctggtcgccaccggcgccagcccgcggatcctgccg
tcggcccagccggacggtgagcgcattctgacctggcggcagctctacgacttggacgcg
ttgcccgaccacctcatcgtggtgggctccggggttaccggtgctgagttcgtggacgcc
tataccgaattgggggtgccggtcacggtggtggccagccaggaccacgtgctgccgtat
gaggacgctgacgctgcgctggtcctggaagagtcgttcgccgaacggggagtccggctg
ttcaaaaatgcccgggcagcatcggtcacccgcaccggggccggggtgctcgtcacgatg
accgacggtcgcaccgtcgagggcagccacgccctgatgaccatcgggtcggtgcccaac
accagcggcctgggcctggaacgggtcggcatccagcttggccggggcaattacctgacc
gtggaccgggtgtcgcggacgttggcgaccggcatctacgccgcgggcgactgcacgggt
ttgctgcccctggcgtcggtcgccgcaatgcagggccgcatcgcgatgtaccacgcgctg
ggggagggcgtcagcccgatccggttacgcacggtggccgcgacggttttcaccaggccc
gagatcgccgcggtcggggtgccgcaatcggtcatcgacgccggttcggtggccgcccgg
accatcatgctgccgttacgaaccaacgcgcgcgccaagatgtcggagatgcgtcacggg
ttcgtcaagatcttctgccggcggtccaccggcgttgtgatcggcggcgtggtggtggcg
ccgatcgcatcggagctgatcctgcccatcgccgtagccgttcagaaccgcatcaccgtc
aacgagctggcccagacactggccgtttacccatcgttgtcgggttcgataaccgaggcg
gcccgccggctgatggcgcacgacgatctggactgcacggcagctcaagacgcggctgaa
caactagccttggtgccacaccacctaccgacgagtaactga

DBGET integrated database retrieval system