KEGG   Mycobacterium tuberculosis H37Rv: Rv3309cHelp
Entry
Rv3309c           CDS       T00015                                 

Gene name
upp
Definition
(RefSeq) uracil phosphoribosyltransferase
  KO
K00761  
uracil phosphoribosyltransferase [EC:2.4.2.9]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Rv3309c (upp)
Enzymes [BR:mtu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.9  uracil phosphoribosyltransferase
     Rv3309c (upp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(3696470..3697093)
Genome map
AA seq 207 aa AA seqDB search
MQVHVVDHPLAAARLTTLRDERTDNAGFRAALRELTLLLIYEATRDAPCEPVPIRTPLAE
TVGSRLTKPPLLVPVLRAGLGMVDEAHAALPEAHVGFVGVARDEQTHQPVPYLDSLPDDL
TDVPVMVLDPMVATGGSMTHTLGLLISRGAADITVLCVVAAPEGIAALQKAAPNVRLFTA
AIDEGLNEVAYIVPGLGDAGDRQFGPR
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
gtgcaggtccatgtcgttgaccacccactggccgcggcccgactgaccacgctgcgtgac
gaacgcaccgacaacgccggcttccgggcagcgctgcgcgagctcacgctgctgttgatc
tatgaggccacccgcgatgcgccctgcgagccagtcccgatccgtacgccgctggccgag
acggtcgggtcgcggctaaccaagccacccctgctggttcctgtgttgcgggcggggttg
gggatggtcgacgaggcgcatgccgccttgccggaggcgcacgttggctttgtcggtgtc
gcccgcgacgagcaaacccaccagccggtgccgtatctggactcgctgcccgacgacctg
acggatgtaccggtcatggtgcttgacccgatggtggccaccggcgggtcgatgacgcac
accctcggtctgctgatctcgcgcggtgcagcggatatcacggtgctgtgtgtggttgcg
gcgccagaaggaatcgcggcgctgcagaaggctgcgccaaacgtgcggttgttcactgcg
gccatcgacgaagggcttaacgaggtcgcctacattgtgcccggtctcggcgatgccggc
gatcgccagttcggcccgcgctga

DBGET integrated database retrieval system