KEGG   Mycobacterium tuberculosis H37Rv: Rv3313cHelp
Entry
Rv3313c           CDS       T00015                                 

Gene name
add
Definition
(RefSeq) adenosine deaminase
  KO
K01488  
adenosine deaminase [EC:3.5.4.4]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Purine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtu00001]
  Nucleotide metabolism
   00230 Purine metabolism
    Rv3313c (add)
Enzymes [BR:mtu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.4  adenosine deaminase
     Rv3313c (add)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
complement(3701087..3702184)
Genome map
AA seq 365 aa AA seqDB search
MTAAPTLQTIRLAPKALLHDHLDGGLRPATVLDIAGQVGYDDLPATDVDALASWFRTQSH
SGSLERYLEPFSHTVAVMQTPEALYRVAFECAQDLAADSVVYAEVRFAPELHISCGLSFD
DVVDTVLTGFAAGEKACAADGQPITVRCLVTAMRHAAMSREIAELAIRFRDKGVVGFDIA
GAEAGHPPTRHLDAFEYMRDHNARFTIHAGEAFGLPSIHEAIAFCGADRLGHGVRIVDDI
DVDADGGFQLGRLAAILRDKRIPLELCPSSNVQTGAVASIAEHPFDLLARARFRVTVNTD
NRLMSDTSMSLEMHRLVEAFGYGWSDLARFTVNAMKSAFIPFDQRLAIIDEVIKPRFAAL
MGHSE
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaccgctgcgccgaccctgcagacgatcaggctagcccccaaggcgttgctgcacgat
cacctcgacggcgggctgcggccggccaccgtgctggacattgccgggcaggtcggatac
gacgacctgccggcaactgacgtcgacgcgctggcaagttggtttcgcacccagtcgcac
agcggctcgctggagcgctacctggaaccgttttcgcacacggtggcggtgatgcagact
cccgaggccttgtatcgggtcgccttcgaatgcgcgcaagacctggccgccgattcggtg
gtctatgccgaggtgcggttcgcgccggagctgcacatcagctgcgggctgtcgttcgac
gacgtcgtcgacaccgttctgacgggcttcgccgccggcgagaaggcgtgtgccgccgat
ggtcaacccatcaccgtccgctgtctggtcaccgcgatgcggcacgccgcaatgtcccgg
gagatcgcagagttggcgatccggttccgggacaagggagttgtcggattcgacatcgcc
ggcgcggaggccggccacccgccaacccggcacttggatgcattcgagtacatgcgtgat
cacaacgcgcgcttcacgattcatgccggtgaggcgttcgggttgccgtccatccacgag
gcgatcgccttctgcggtgccgaccggctgggtcacggggtgcggatcgtcgacgacatc
gacgtggatgccgacggcggtttccagttgggtcggctggcagctatcctgcgggacaag
cgaattccgctggagctgtgccccagctccaacgtgcagaccggcgcggtcgcaagcatc
gccgagcatccgttcgacctactggctcgggcccggttccgggtgaccgtcaataccgac
aaccggctgatgagcgacacctcgatgagcctcgaaatgcatcgtttggtagaggctttc
ggttatggctggagcgacctggcgcgcttcaccgtcaatgcgatgaaatccgcgttcatt
ccgttcgaccagcggctggcgataatcgacgaagtgatcaagccgcggttcgcggcgctc
atgggtcacagcgagtaa

DBGET integrated database retrieval system