KEGG   Mycobacterium tuberculosis H37Rv: Rv3318Help
Entry
Rv3318            CDS       T00015                                 

Gene name
sdhA
Definition
(RefSeq) succinate dehydrogenase flavoprotein subunit
  KO
K00239  
succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rv3318 (sdhA)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Rv3318 (sdhA)
   00650 Butanoate metabolism
    Rv3318 (sdhA)
  Energy metabolism
   00190 Oxidative phosphorylation
    Rv3318 (sdhA)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Rv3318 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     Rv3318 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
3705000..3706772
Genome map
AA seq 590 aa AA seqDB search
MICQHRYDVVIVGAGGAGMRAAVEAGPRVRTAVLTKLYPTRSHTGAAQGGMCAALANVED
DNWEWHTFDTVKGGDYLADQDAVEIMCKEAIDAVLDLEKMGMPFNRTPEGRIDQRRFGGH
TRDHGKAPVRRACYAADRTGHMILQTLYQNCVKHDVEFFNEFYALDLALTQTPSGPVATG
VIAYELATGDIHVFHAKAVVIATGGSGRMYKTTSNAHTLTGDGIGIVFRKGLPLEDMEFH
QFHPTGLAGLGILISEAVRGEGGRLLNGEGERFMERYAPTIVDLAPRDIVARSMVLEVLE
GRGAGPLKDYVYIDVRHLGEEVLEAKLPDITEFARTYLGVDPVTELVPVYPTCHYLMGGI
PTTVTGQVLRDNTSVVPGLYAAGECACVSVHGANRLGTNSLLDINVFGRRAGIAAASYAQ
GHDFVDMPPNPEAMVVGWVSDILSEHGNERVADIRGALQQSMDNNAAVFRTEETLKQALT
DIHALKERYSRITVHDKGKRFNTDLLEAIELGFLLELAEVTVVGALNRKESRGGHAREDY
PNRDDVNYMRHTMAYKEIGADKEGPELRSDVRLDFKPVVQTRYEPKERKY
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
ttgatctgccaacaccgatacgacgtggtgatcgtcggcgcgggcggtgccgggatgcgc
gccgcggtcgaggcgggtccgcgggtgcgtaccgcggtgctgaccaagctgtatcccacc
cgcagccacaccggcgcggcccagggcggcatgtgcgccgcgctggccaacgtcgaggac
gacaactgggagtggcacacgttcgacaccgtcaagggcggcgactatctcgccgaccag
gacgccgtggagatcatgtgcaaggaagccatcgacgcggtgctcgacctggagaagatg
gggatgccgttcaaccgcacccccgagggccgcatcgaccagcgccgcttcggcgggcac
acccgcgaccacggcaaggccccggtgcgccgggcctgctacgcggccgatcgcaccggc
cacatgattctgcagacgctgtatcagaactgcgtcaagcacgacgtcgagttcttcaac
gagttttacgcgctggatttggctttgactcaaacgccgtcgggcccggtggccaccggg
gtgatcgcctacgagctagcgaccggtgacatccatgtctttcacgccaaggccgtcgtg
atcgcgaccggcggctcgggccgcatgtataagaccacgtccaacgcacacaccctgacc
ggcgacggcatcggcatcgtgttccgcaagggacttcccttggaggacatggagtttcac
cagtttcaccctaccggcctggccggtctgggcatcttaatctccgaagcggtgcgcggc
gaaggcggccggctgctcaacggggaaggtgagcgtttcatggagcgctacgccccgacg
atcgtcgacctagcgccccgcgacatcgtcgcccgctcgatggtgctggaagtgctggag
ggacgcggcgccggaccgctcaaggactacgtctacatcgacgtccgccacctgggcgag
gaagtgctcgaggccaagctgcccgacatcaccgagttcgcccgcacctacctgggcgtg
gatccggtcaccgagctggtgccggtctacccgacgtgccactacctgatgggcggcatc
ccgaccacagtcaccgggcaggtgctgcgggacaacaccagcgttgtcccgggcctgtat
gcggccggcgagtgcgcgtgcgtgtcggtgcatggcgccaaccggctgggcaccaactcg
ctgttggatatcaacgtcttcggtcgtcgggccggcatcgccgccgccagttatgcgcag
ggtcacgactttgtcgacatgccgcccaacccggaggccatggtggtgggctgggtcagc
gacatcctgtccgaacacggaaacgagcgggtcgccgacattcgcggggcgctgcagcag
tcgatggacaacaacgccgcggtgttccgcaccgaggagaccctgaagcaggcgctcacc
gacatccacgcgctcaaggagcgctactcccgaatcacggtgcacgacaaggggaaacgc
ttcaacaccgacctgctggaagccatcgagctgggatttttactggagctggccgaggtc
acggtggtcggcgctttgaatcgcaaggagtcccgcggcggtcacgcccgcgaggactat
cccaaccgcgacgacgtcaactacatgcgacacaccatggcctacaaggaaattggggcc
gataaggagggccccgagctgcgcagcgatgtccgccttgatttcaaacccgtcgtgcag
acccgttacgaacccaaggaacggaagtactaa

DBGET integrated database retrieval system