KEGG   Mycobacterium tuberculosis H37Rv: Rv3339cHelp
Entry
Rv3339c           CDS       T00015                                 

Gene name
icd1
Definition
(RefSeq) isocitrate dehydrogenase
  KO
K00031  
isocitrate dehydrogenase [EC:1.1.1.42]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Citrate cycle (TCA cycle)
Glutathione metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Rv3339c (icd1)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Rv3339c (icd1)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     Rv3339c (icd1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(3724615..3725844)
Genome map
AA seq 409 aa AA seqDB search
MSNAPKIKVSGPVVELDGDEMTRVIWKLIKDMLILPYLDIRLDYYDLGIEHRDATDDQVT
IDAAYAIKKHGVGVKCATITPDEARVEEFNLKKMWLSPNGTIRNILGGTIFREPIVISNV
PRLVPGWTKPIVIGRHAFGDQYRATNFKVDQPGTVTLTFTPADGSAPIVHEMVSIPEDGG
VVLGMYNFKESIRDFARASFSYGLNAKWPVYLSTKNTILKAYDGMFKDEFERVYEEEFKA
QFEAAGLTYEHRLIDDMVAACLKWEGGYVWACKNYDGDVQSDTVAQGYGSLGLMTSVLMT
ADGKTVEAEAAHGTVTRHYRQYQAGKPTSTNPIASIFAWTRGLQHRGKLDGTPEVIDFAH
KLESVVIATVESGKMTKDLAILIGPEQDWLNSEEFLDAIADNLEKELAN
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgtccaacgcacccaagataaaagtcagcggtccggtcgtagagctcgacggtgacgag
atgacccgtgtcatctggaagctcatcaaggacatgcttatccttccctatctcgacatc
cgcttggactattacgacttgggcatcgagcaccgcgacgccaccgacgaccaggtgacg
atcgacgcggcgtatgcgatcaagaaacacggtgtgggcgtaaagtgcgcgacgatcacc
cccgacgaggcccgtgtcgaggaattcaacctgaagaagatgtggctgtcgcccaatggg
acaatccggaacatcttgggcggcacaatctttcgcgaacctatcgtgatttctaatgtg
ccgcgactggttccggggtggaccaagccgatcgtcatcggccggcacgcttttggtgac
caatatcgggcgacgaacttcaaggtcgaccaaccgggcaccgtcacactgactttcacg
cccgccgacggcagcgcgccgatcgtgcacgaaatggtgtccatccccgaggacggcggc
gtcgtgctggggatgtacaacttcaaggaatccatccgggatttcgcgcgcgcgtcgttc
tcctacggcctcaacgcgaaatggccggtatatctgtccaccaagaacaccatcctcaag
gcctacgacgggatgttcaaagacgagttcgagcgcgtctacgaagaggaattcaaggcg
cagttcgaagcggcggggctgacctacgagcatcggttgatcgacgacatggtcgccgcc
tgcctgaaatgggaaggcggttacgtctgggcgtgcaagaactacgacggcgacgtgcag
tcggacaccgtcgcacagggctacggctcgctgggcctgatgacgtcggtgctgatgacg
gccgacggcaagacagtcgaggccgaagccgcccacggcaccgtcacccggcattaccgg
cagtatcaggccggtaaaccgacctcaacaaacccgatcgcgtcgatctttgcctggacc
cgcggattacagcatcgcggcaagctggatggcactcccgaagtcatcgacttcgcccac
aagctggagtccgtcgtcatcgccacggtggagagcgggaagatgaccaaggacctcgcg
atcctcatcggtccggagcaggactggctgaatagcgaggaattcctcgatgcgatcgcc
gacaacctggaaaaggagctggccaattag

DBGET integrated database retrieval system