KEGG   Mycobacterium tuberculosis H37Rv: Rv3339cHelp
Entry
Rv3339c           CDS       T00015                                 

Gene name
icd1
Definition
(RefSeq) isocitrate dehydrogenase
  KO
K00031  
isocitrate dehydrogenase [EC:1.1.1.42]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Citrate cycle (TCA cycle)
Glutathione metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rv3339c (icd1)
   01210 2-Oxocarboxylic acid metabolism
    Rv3339c (icd1)
   01230 Biosynthesis of amino acids
    Rv3339c (icd1)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Rv3339c (icd1)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Rv3339c (icd1)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     Rv3339c (icd1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(3724615..3725844)
Genome map
AA seq 409 aa AA seqDB search
MSNAPKIKVSGPVVELDGDEMTRVIWKLIKDMLILPYLDIRLDYYDLGIEHRDATDDQVT
IDAAYAIKKHGVGVKCATITPDEARVEEFNLKKMWLSPNGTIRNILGGTIFREPIVISNV
PRLVPGWTKPIVIGRHAFGDQYRATNFKVDQPGTVTLTFTPADGSAPIVHEMVSIPEDGG
VVLGMYNFKESIRDFARASFSYGLNAKWPVYLSTKNTILKAYDGMFKDEFERVYEEEFKA
QFEAAGLTYEHRLIDDMVAACLKWEGGYVWACKNYDGDVQSDTVAQGYGSLGLMTSVLMT
ADGKTVEAEAAHGTVTRHYRQYQAGKPTSTNPIASIFAWTRGLQHRGKLDGTPEVIDFAH
KLESVVIATVESGKMTKDLAILIGPEQDWLNSEEFLDAIADNLEKELAN
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgtccaacgcacccaagataaaagtcagcggtccggtcgtagagctcgacggtgacgag
atgacccgtgtcatctggaagctcatcaaggacatgcttatccttccctatctcgacatc
cgcttggactattacgacttgggcatcgagcaccgcgacgccaccgacgaccaggtgacg
atcgacgcggcgtatgcgatcaagaaacacggtgtgggcgtaaagtgcgcgacgatcacc
cccgacgaggcccgtgtcgaggaattcaacctgaagaagatgtggctgtcgcccaatggg
acaatccggaacatcttgggcggcacaatctttcgcgaacctatcgtgatttctaatgtg
ccgcgactggttccggggtggaccaagccgatcgtcatcggccggcacgcttttggtgac
caatatcgggcgacgaacttcaaggtcgaccaaccgggcaccgtcacactgactttcacg
cccgccgacggcagcgcgccgatcgtgcacgaaatggtgtccatccccgaggacggcggc
gtcgtgctggggatgtacaacttcaaggaatccatccgggatttcgcgcgcgcgtcgttc
tcctacggcctcaacgcgaaatggccggtatatctgtccaccaagaacaccatcctcaag
gcctacgacgggatgttcaaagacgagttcgagcgcgtctacgaagaggaattcaaggcg
cagttcgaagcggcggggctgacctacgagcatcggttgatcgacgacatggtcgccgcc
tgcctgaaatgggaaggcggttacgtctgggcgtgcaagaactacgacggcgacgtgcag
tcggacaccgtcgcacagggctacggctcgctgggcctgatgacgtcggtgctgatgacg
gccgacggcaagacagtcgaggccgaagccgcccacggcaccgtcacccggcattaccgg
cagtatcaggccggtaaaccgacctcaacaaacccgatcgcgtcgatctttgcctggacc
cgcggattacagcatcgcggcaagctggatggcactcccgaagtcatcgacttcgcccac
aagctggagtccgtcgtcatcgccacggtggagagcgggaagatgaccaaggacctcgcg
atcctcatcggtccggagcaggactggctgaatagcgaggaattcctcgatgcgatcgcc
gacaacctggaaaaggagctggccaattag

DBGET integrated database retrieval system