KEGG   Mycobacterium tuberculosis H37Rv: Rv3341Help
Entry
Rv3341            CDS       T00015                                 

Gene name
metA
Definition
(RefSeq) homoserine O-acetyltransferase
  KO
K00641  
homoserine O-acetyltransferase [EC:2.3.1.31]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Rv3341 (metA)
Enzymes [BR:mtu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     Rv3341 (metA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Position
3727488..3728627
Genome map
AA seq 379 aa AA seqDB search
MTISDVPTQTLPAEGEIGLIDVGSLQLESGAVIDDVCIAVQRWGKLSPARDNVVVVLHAL
TGDSHITGPAGPGHPTPGWWDGVAGPGAPIDTTRWCAVATNVLGGCRGSTGPSSLARDGK
PWGSRFPLISIRDQVQADVAALAALGITEVAAVVGGSMGGARALEWVVGYPDRVRAGLLL
AVGARATADQIGTQTTQIAAIKADPDWQSGDYHETGRAPDAGLRLARRFAHLTYRGEIEL
DTRFANHNQGNEDPTAGGRYAVQSYLEHQGDKLLSRFDAGSYVILTEALNSHDVGRGRGG
VSAALRACPVPVVVGGITSDRLYPLRLQQELADLLPGCAGLRVVESVYGHDGFLVETEAV
GELIRQTLGLADREGACRR
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgacgatctccgatgtacccacccagacgctgcccgccgaaggcgaaatcggcctgata
gacgtcggctcgctgcaactggaaagcggggcggtgatcgacgatgtctgtatcgccgtg
caacgctggggcaaattgtcgcccgcacgggacaacgtggtggtggtcttgcacgcgctc
accggcgactcgcacatcactggacccgccggacccggccaccccacccccggctggtgg
gacggggtggccgggccgggtgcgccgattgacaccacccgctggtgcgcggtagctacc
aatgtgctcggcggctgccgcggctccaccgggcccagctcgcttgcccgcgacggaaag
ccttggggctcaagatttccgctgatctcgatacgtgaccaggtgcaggcggacgtcgcg
gcgctggccgcgctgggcatcaccgaggtcgccgccgtcgtcggcggctccatgggcggc
gcccgggccctggaatgggtggtcggctacccggatcgggtccgagccggattgctgctg
gcggtcggtgcgcgtgccaccgcagaccagatcggcacgcagacaacgcaaatcgcggcc
atcaaagccgacccggactggcagagcggcgactaccacgagacggggagggcaccagac
gccgggctgcgactcgcccgccgcttcgcgcacctcacctaccgcggcgagatcgagctc
gacacccggttcgccaaccacaaccagggcaacgaggatccgacggccggcgggcgctac
gcggtgcaaagttatctggaacaccaaggagacaaactgttatcccggttcgacgccggc
agctacgtgattctcaccgaggcgctcaacagccacgacgtcggccgcggccgcggcggg
gtctccgcggctctgcgcgcctgcccggtgccggtggtggtgggcggcatcacctccgac
cggctctacccgctgcgcctgcagcaggagctggccgacctgctgccgggctgcgccggg
ctgcgagtcgtcgagtcggtctacggacacgacggcttcctggtggaaaccgaggccgtg
ggcgaattgatccgccagacactgggattggctgatcgtgaaggcgcgtgtcggcggtga

DBGET integrated database retrieval system