KEGG   Mycobacterium tuberculosis H37Rv: Rv3372Help
Entry
Rv3372            CDS       T00015                                 

Gene name
otsB2
Definition
(RefSeq) trehalose 6-phosphate phosphatase
  KO
K01087  
trehalose 6-phosphate phosphatase [EC:3.1.3.12]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Rv3372 (otsB2)
Enzymes [BR:mtu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.12  trehalose-phosphatase
     Rv3372 (otsB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Position
3786314..3787489
Genome map
AA seq 391 aa AA seqDB search
MRKLGPVTIDPRRHDAVLFDTTLDATQELVRQLQEVGVGTGVFGSGLDVPIVAAGRLAVR
PGRCVVVSAHSAGVTAARESGFALIIGVDRTGCRDALRRDGADTVVTDLSEVSVRTGDRR
MSQLPDALQALGLADGLVARQPAVFFDFDGTLSDIVEDPDAAWLAPGALEALQKLAARCP
IAVLSGRDLADVTQRVGLPGIWYAGSHGFELTAPDGTHHQNDAAAAAIPVLKQAAAELRQ
QLGPFPGVVVEHKRFGVAVHYRNAARDRVGEVAAAVRTAEQRHALRVTTGREVIELRPDV
DWDKGKTLLWVLDHLPHSGSAPLVPIYLGDDITDEDAFDVVGPHGVPIVVRHTDDGDRAT
AALFALDSPARVAEFTDRLARQLREAPLRAT
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcaagttgggcccggtcaccatcgatccgcgccgccatgacgcggtgctgttcgac
accacgttggacgccacccaggaactggtccggcaactccaggaagtcggtgtgggcacc
ggcgtcttcggtagtggcctagacgttccgatcgtagcggccggccgtctggcggtgcgg
ccgggccggtgcgtggtcgtctcggcccactcggcgggcgtcacggccgcacgcgaaagc
ggatttgcgctgatcatcggtgtcgaccgcaccgggtgtcgggacgcattgcgtcgcgac
ggcgccgacacggtggtcaccgacctaagcgaggtcagcgtgcgcaccggggaccgacgc
atgtcgcagctgcccgacgcgttacaggcactcggcctggccgacggcctggtcgcccgg
cagcccgcggtgttcttcgacttcgacggcacgctgtccgacattgtcgaggatcccgac
gcggcctggctcgcccccggtgccttggaggcactgcagaagttggccgcgcgctgtccg
atcgcggtgctcagtggccgcgacctggccgacgtgacacagcgggtgggtctgcccggc
atctggtatgccggcagccatggtttcgaattgaccgcacccgacggaacgcaccaccag
aacgacgccgcggcggcagccataccggtgctgaaacaggcggctgccgagctgcgccag
caacttggacccttcccgggtgttgtggtggagcacaagcggtttggcgtcgccgtgcac
taccgcaacgcggcccgggaccgggtcggcgaagtcgccgcggcggtgcgcacggccgag
cagcgtcatgcgctgcgggtgacgacgggccgcgaagtcatcgagttgcgtcccgatgtc
gactgggacaaggggaaaacgctgctgtgggttcttgaccatctgccgcattcgggctcg
gctcccctggtgccgatctacctcggcgacgacatcaccgacgaggacgctttcgatgtg
gtcggcccccatggtgttccaattgtggtgcgccacaccgacgacggtgaccgcgccacc
gccgcactgtttgcgctggacagtcccgcacgggtcgcggagttcaccgatcggctggcg
cgtcagctccgtgaggctcccctgcgggcaacgtga

DBGET integrated database retrieval system