KEGG   Mycobacterium tuberculosis H37Rv: Rv3379cHelp
Entry
Rv3379c           CDS       T00015                                 

Gene name
dxs2
Definition
(RefSeq) 1-deoxy-D-xylulose-5-phosphate synthase
  KO
K01662  
1-deoxy-D-xylulose-5-phosphate synthase [EC:2.2.1.7]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Thiamine metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    Rv3379c (dxs2)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Rv3379c (dxs2)
Enzymes [BR:mtu01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.7  1-deoxy-D-xylulose-5-phosphate synthase
     Rv3379c (dxs2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Position
complement(3793257..3794867)
Genome map
AA seq 536 aa AA seqDB search
MFDTGHQTYPHKLLTGRGKDFATLRQADGLSGYPNRHESPHDWVENSHASVSLAWVDGIA
KALALQGQCDRRVIAVIGDGALTGGVAWEGLNNLGAATRPVIVVLNDNGRSYDPTAGALA
AHLEELRVGTPRGPNLFENMGFTYIGPVDGHNIPDTCAVLRKAAAAARPVVVHAVTSKGR
GYPPAEADERDHMHACGVVDIATGLASTPSQRSWTDVFEDEIARIADDRSDVVGLTAAMR
LPTGLGALSRRYPHRVFDSGIAEQHLLASAAGLAAAGTHPVVAVYSTFLHRAFDQLLFDI
GLHRLPVTLVLDRAGVTGPDGPSHHGLWDLALLACVPGFQIACPRDAPRLRQQLRTAIAT
AAPTAVRFPKGAPGEPITAEHTIGGLDVLHTPPPHWRPDVLLVAVGAMSRPCMDAARCLS
EEQIGVTVVDPQWVWPISPALTELAGRHRITVCVEDAIADVGIGAHLSHHIGRTHPRTRT
YTLGLPPAYIPHASRDHILSSHGLTGPAIRIRCKSLLNALHEVPGPEDHPDSGDSY
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
gtgttcgacaccgggcaccaaacctatccgcacaagctgctcaccggccgcggtaaagac
ttcgccacgctgcgccaggccgatggtctatcggggtatcccaaccgccatgaatcgcca
catgactgggtcgagaactcccatgcctcggtcagcctcgcctgggtggacggcatcgcc
aaagcattggccctgcaggggcaatgcgaccgacgtgtcatcgcggtgatcggtgatggc
gccctcaccgggggcgtggcatgggagggcctgaacaacctcggtgccgctacccggccc
gtgatcgtcgtgctcaatgacaatggccgctcctacgaccccaccgctggggctcttgcg
gcacacctagaagaacttcgcgtcggcacaccccgagggccgaacctctttgagaacatg
ggatttacctacatcggtccggtcgatgggcacaacatccccgacacgtgcgcggttcta
cgaaaagcggccgcggcagctaggcccgttgttgttcacgcagtgactagtaagggccgg
ggttatcctccagccgaagctgacgagagggaccatatgcacgcctgcggggtggtcgac
attgccaccggcctcgctagcacacccagtcagcggagctggaccgacgtgttcgaggac
gaaatcgcgcgcattgctgacgaccgatccgacgtcgtcgggctgaccgcggcgatgcgt
ctgcccactggtctaggcgcgctgtcgaggcgatacccgcatcgggtgttcgattcgggc
atcgccgaacaacacctgttggccagcgcggccgggctagctgccgcgggaacccatccc
gttgtcgcggtgtactcgacgtttctgcaccgcgcctttgaccaacttctgttcgacatc
gggctgcaccggttacccgtgacgctggtgctggaccgggctggggtaaccgggcccgac
ggacccagccatcacggtttgtgggatctggcgctgctggcctgcgtgcccgggtttcag
atcgcctgtccgcgcgacgcgcctcggctacgacaacagttgcgtaccgcgatcgcgacc
gcggctcccaccgccgtgcgtttccccaaaggggcgccgggcgaaccgatcacggccgaa
cacaccatcggtggcctcgacgtcttgcatacaccaccaccgcattggcgacccgacgtg
ctcttggtcgcagtgggtgccatgagtcgaccatgcatggacgccgcccggtgcctcagc
gaggagcagatcggggtgacagtcgttgatccacaatgggtctggccaatcagcccggca
ctgaccgagctggctggccgccatcggatcaccgtgtgtgtcgaagatgcgattgccgac
gtgggaatcggcgcgcaccttagccaccacatcgggcggacacacccgcggacgcgcacc
tacacactgggactgccaccggcctacattccccacgccagccgcgaccacatcctttcc
agccacggactcaccggccccgcaatccgcataagatgcaaatcactacttaacgcacta
catgaagtccctggacccgaagaccatcctgattccggcgatagttattaa

DBGET integrated database retrieval system