KEGG   Mycobacterium tuberculosis H37Rv: Rv3382cHelp
Entry
Rv3382c           CDS       T00015                                 

Definition
(RefSeq) 4-hydroxy-3-methylbut-2-enyl diphosphate reductase
  KO
K03527  
4-hydroxy-3-methylbut-2-en-1-yl diphosphate reductase [EC:1.17.7.4]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Rv3382c
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.7  With an iron-sulfur protein as acceptor
    1.17.7.4  4-hydroxy-3-methylbut-2-en-1-yl diphosphate reductase
     Rv3382c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
complement(3796448..3797437)
Genome map
AA seq 329 aa AA seqDB search
MAEVFVGPVAQGYASGEVTVLLASPRSFCAGVERAIETVKRVLDVAEGPVYVRKQIVHNT
VVVAELRDRGAVFVEDLDEIPDPPPPGAVVVFSAHGVSPAVRAGADERGLQVVDATCPLV
AKVHAEAARFAARGDTVVFIGHAGHEETEGTLGVAPRSTLLVQTPADVAALNLPEGTQLS
YLTQTTLALDETADVIDALRARFPTLGQPPSEDICYATTNRQRALQSMVGECDVVLVIGS
CNSSNSRRLVELAQRSGTPAYLIDGPDDIEPEWLSSVSTIGVTAGASAPPRLVGQVIDAL
RGYASITVVERSIATETVRFGLPKQVRAQ
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atggctgaggtgttcgtgggaccggtcgcacagggatacgcttcgggtgaagtcacggtg
ctgttggcgtcgccgcggtcgttttgcgccggtgtagagcgtgctatcgagacggtcaag
cgagtgcttgacgtggccgaaggcccggtgtatgtgcgcaagcaaatcgtgcacaacact
gttgtggttgccgagttgcgggaccggggagcagtgttcgtcgaggatctcgacgagatt
cccgatccgccgccgccgggggcggtcgtggtgttctccgcgcatggggtttccccggcg
gtgcgcgcgggcgctgatgagcggggactgcaggtcgtcgacgcgacctgcccactggtg
gcgaaagtccacgctgaagccgcacggtttgccgcgcgcggtgacacggtggtcttcatc
gggcacgccggacatgaggagaccgaaggcacgcttggcgtcgctccgcggtcaacatta
ttggtgcagacacccgctgatgtggcagcgttgaacctgcccgagggtacccagctatcg
tatctgacccagacaaccctggcacttgatgaaactgccgatgtcattgatgcgctgcgc
gcgaggtttccgacgttgggccaacccccctctgaagacatctgctatgccaccacgaac
agacagcgtgcgctgcaatcgatggtcggtgaatgtgacgttgtgttggtgattggctcg
tgcaattcgtcgaattcgcggcgtctggtcgagttggcgcagcgaagtgggacgccggcc
tacttgattgacgggcctgatgacattgagcccgaatggctgtcgtcggtctcgacgatc
ggtgtcaccgcgggagcctccgcgccgccacgactggtggggcaggtgattgatgcactt
cgcggatacgcctcgatcaccgtggtggaacgctcgatagcgaccgagacggtgcgattc
ggccttcccaaacaggttcgcgcgcaatga

DBGET integrated database retrieval system