KEGG   Mycobacterium tuberculosis H37Rv: Rv3396cHelp
Entry
Rv3396c           CDS       T00015                                 

Gene name
guaA
Definition
(RefSeq) GMP synthase
  KO
K01951  
GMP synthase (glutamine-hydrolysing) [EC:6.3.5.2]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Rv3396c (guaA)
Enzymes [BR:mtu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.2  GMP synthase (glutamine-hydrolysing)
     Rv3396c (guaA)
Peptidases [BR:mtu01002]
 Cysteine Peptidases
  Family C26: gamma-glutamyl hydrolase family
   Rv3396c (guaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Position
complement(3812501..3814078)
Genome map
AA seq 525 aa AA seqDB search
MVQPADIDVPETPARPVLVVDFGAQYAQLIARRVREARVFSEVIPHTASIEEIRARQPVA
LVLSGGPASVYADGAPKLDPALLDLGVPVLGICYGFQAMAQALGGIVAHTGTREYGRTEL
KVLGGKLHSDLPEVQPVWMSHGDAVTAAPDGFDVVASSAGAPVAAFEAFDRRLAGVQYHP
EVMHTPHGQQVLSRFLHDFAGLGAQWTPANIANALIEQVRTQIGDGHAICGLSGGVDSAV
AAALVQRAIGDRLTCVFVDHGLLRAGERAQVQRDFVAATGANLVTVDAAETFLEALSGVS
APEGKRKIIGRQFIRAFEGAVRDVLDGKTAEFLVQGTLYPDVVESGGGSGTANIKSHHNV
GGLPDDLKFTLVEPLRLLFKDEVRAVGRELGLPEEIVARQPFPGPGLGIRIVGEVTAKRL
DTLRHADSIVREELTAAGLDNQIWQCPVVLLADVRSVGVQGDGRTYGHPIVLRPVSSEDA
MTADWTRVPYEVLERISTRITNEVAEVNRVVLDITSKPPATIEWE
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
gtggtgcagcctgctgacatcgacgtgcctgagacaccggctcgaccggtgttggtggtc
gacttcggtgcccaatatgcccagttgattgcccgtcgggttcgagaagcacgggttttc
tccgaggtgattccgcacaccgcctcgatcgaggagatcagggcccgtcagccggtggcg
ctcgtgctttccggtggaccggccagtgtctacgccgacggcgctccgaaactcgatccg
gcgctactggacctcggtgtaccggttcttggcatctgctacgggtttcaggccatggcg
caggcgctcggggggatcgtcgcccacaccggcactcgcgaatacggtcggactgaactg
aaagtccttggtggcaaactgcattcggatcttcccgaggttcagccggtatggatgagt
cacggtgacgcggtcacggccgcgccggacggattcgacgtggtggctagcagcgccggt
gccccggtggccgccttcgaggccttcgaccggcgcctggccggggtgcagtatcacccg
gaggtgatgcacaccccacacgggcaacaggtgctcagccggtttttgcacgacttcgcc
gggctcggcgcccagtggacgcccgccaacatcgccaacgcgctgatcgagcaggtgcgc
acccagatcggcgacggccacgccatctgcgggctatccggcggcgtggattccgcggtg
gccgcggccctggtgcagcgggccatcggcgaccggttgacctgtgtcttcgtcgaccac
gggctgttgcgcgccggtgagcgggcgcaggtgcaacgcgatttcgtggccgccaccggc
gccaacctggtcaccgtcgacgcggccgagaccttcctcgaggcgctgtcgggcgtgagc
gcccccgagggcaaacgcaagatcatcggccgtcagttcatccgcgcgttcgagggcgcg
gtgcgggatgtgctggacggtaagactgctgagttcctggtgcagggcacgctgtatccg
gatgtggtggagtccggcgggggcagcggcaccgcgaacatcaagagccaccacaatgtc
ggcggcctgcccgacgacctgaagttcaccctcgttgagccgctgcggctgctgttcaaa
gacgaggtgcgcgcggtcgggcgggagttgggtctgccggaggagatcgtggcgcgccag
ccgtttccgggaccggggttgggtattcggatcgtcggggaggtcaccgccaagcggttg
gatacgctgcggcacgccgattcgatcgtgcgtgaggagctgaccgcggcgggcctggac
aaccagatctggcagtgtccggtggtgctgttggccgatgtccgctcggtgggtgtgcag
ggtgacggtcgcacctatggccacccgattgtgctgcgtccggtgtcgagtgaagacgcg
atgaccgccgactggacccgggtgccctacgaggtgctcgagcgcatctcgacccggatc
accaacgaggtcgccgaggtcaaccgcgtggtgctggacatcaccagcaagccgcccgcc
accatcgagtgggagtag

DBGET integrated database retrieval system