KEGG   Mycobacterium tuberculosis H37Rv: Rv3398cHelp
Entry
Rv3398c           CDS       T00015                                 

Gene name
idsA1
Definition
(RefSeq) multifunctional dimethylallyltransferase/geranyltranstransferase/farnesylt ranstransferase
  KO
K13787  
geranylgeranyl diphosphate synthase, type I [EC:2.5.1.1 2.5.1.10 2.5.1.29]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Module
C10-C20 isoprenoid biosynthesis, bacteria
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Rv3398c (idsA1)
Enzymes [BR:mtu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     Rv3398c (idsA1)
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     Rv3398c (idsA1)
    2.5.1.29  geranylgeranyl diphosphate synthase
     Rv3398c (idsA1)
Prenyltransferases [BR:mtu01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   Rv3398c (idsA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
complement(3815027..3816106)
Genome map
AA seq 359 aa AA seqDB search
MRGTDEKYGLPPQPDSDRMTRRTLPVLGLAHELITPTLRQMADRLDPHMRPVVSYHLGWS
DERGRPVNNNCGKAIRPALVFVAAEAAGADPHSAIPGAVSVELVHNFSLVHDDLMDRDEH
RRHRPTVWALWGDAMALLAGDAMLSLAHEVLLDCDSPHVGAALRAISEATRELIRGQAAD
TAFESRTDVALDECLKMAEGKTAALMAASAEVGALLAGAPRSVREALVAYGRHIGLAFQL
VDDLLGIWGRPEITGKPVYSDLRSRKKTLPVTWTVAHGGSAGRRLAAWLVDETGSQTASD
DELAAVAELIECGGGRRWASAEARRHVTQGIDMVARIGIPDRPAAELQDLAHYIVDRQA
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgcgcggtaccgacgaaaagtacggactgccaccgcaacccgacagcgaccgtatgacc
cgtcgcacgcttcccgttttgggactcgcacacgaactcatcacaccgacgctgcgccag
atggctgaccgcctcgatccccacatgcggcccgtcgtgtcctaccacctcggctggtct
gatgaacgcggccgtccagtgaacaacaactgcggcaaggcaatccgtcctgctttggtg
tttgtcgccgccgaagccgccggcgccgacccccactcggcgattcccggagccgtctcg
gttgaactggtgcacaacttctcgctcgtccatgacgacctcatggaccgcgacgagcac
cgtcggcaccggccgacggtgtgggcactgtggggcgatgcgatggcgctattggccggt
gatgcgatgctgtcgctggcgcacgaggtcctgctggattgcgattcaccacacgtcggt
gcggcgctgcgcgcgatttcggaagccacccgtgagttgatccgtgggcaggccgccgac
accgcgttcgaaagccgaaccgacgtcgcactcgatgagtgtctcaagatggctgaaggc
aagaccgcagcactgatggcagccagcgccgaggtcggcgcgttactcgctggcgcaccg
cgttcggtgcgagaagcgttggttgcctacggtcgtcacattggacttgccttccaattg
gtcgacgacctgctcggcatttggggccgtcctgagatcaccggcaagccggtgtactcg
gaccttcgctcccgcaagaaaactctgcccgttacctggaccgtggcgcacggcggttcg
gccggccgccgcctcgcagcgtggctggtggacgagacgggcagccagacagcgtccgat
gatgagctcgcagcggtcgcagaactgatcgagtgcggtggggggcgcaggtgggcaagc
gcggaggcccgccgacacgtaacgcaaggcatcgacatggtggcgcgcatcggcattccc
gatcgcccggccgctgagcttcaggatttggctcactacatcgtcgatcgtcaggcgtga

DBGET integrated database retrieval system