KEGG   Mycobacterium tuberculosis H37Rv: Rv3400Help
Entry
Rv3400            CDS       T00015                                 

Definition
(RefSeq) hydrolase
Organism
mtu  Mycobacterium tuberculosis H37Rv
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Position
3817239..3818027
Genome map
AA seq 262 aa AA seqDB search
MANWYRPNYPEVRSRVLGLPEKVRACLFDLDGVLTDTASLHTKAWKAMFDAYLAERAERT
GEKFVPFDPAADYHTYVDGKKREDGVRSFLSSRAIEIPDGSPDDPGAAETVYGLGNRKND
MLHKLLRDDGAQVFDGSRRYLEAVTAAGLGVAVVSSSANTRDVLATTGLDRFVQQRVDGV
TLREEHIAGKPAPDSFLRAAELLGVTPDAAAVFEDALSGVAAGRAGNFAVVVGINRTGRA
AQAAQLRRHGADVVVTDLAELL
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atggcgaactggtatcgcccgaactatccggaagtgaggtcccgcgtgctgggtctgccc
gagaaggtgcgtgcttgcctgttcgacctcgacggtgtgctcaccgataccgcgagcctg
cataccaaggcgtggaaggccatgtttgacgcctacctagccgagcgagccgagcgcacc
ggcgaaaaattcgttcccttcgaccctgccgcggactatcacacgtatgtggacggcaag
aaacgcgaagacggcgttcgatcgtttctgagcagccgcgccatcgaaatacccgacggt
tccccggatgacccgggcgccgccgagacggtgtatggcctgggcaaccgcaagaacgac
atgttgcacaagctgctgcgcgacgatggggcccaggtgttcgacgggtcgcggcgctac
ctggaggcggtcacggccgcgggtctcggtgtggccgtggtgtcttcgagcgccaacacc
cgcgacgtgctcgcgaccaccggtctggaccggttcgtccagcagcgggtggacggcgtg
acgttgcgcgaagagcacatcgccggcaagccggcccccgactccttcctgcgcgcggca
gaactgttgggggttacccccgacgcggcggcggtgttcgaggacgccctgtccggggtg
gcggccggccgcgccggcaacttcgccgtagtggtgggcatcaaccgaacgggccgggcg
gctcaggccgcccagttgcgccgccatggcgccgacgtggtggtaaccgatctcgccgag
ctgctgtag

DBGET integrated database retrieval system