KEGG   Mycobacterium tuberculosis H37Rv: Rv3401Help
Entry
Rv3401            CDS       T00015                                 

Definition
(RefSeq) glycosyl hydrolase
Organism
mtu  Mycobacterium tuberculosis H37Rv
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Position
3818042..3820402
Genome map
AA seq 786 aa AA seqDB search
MITEDAFPVEPWQVRETKLNLNLLAQSESLFALSNGHIGLRGNLDEGEPFGLPGTYLNSF
YEIRPLPYAEAGYGYPEAGQTVVDVTNGKIFRLLVGDEPFDVRYGELISHERILDLRAGT
LTRRAHWRSPAGKQVKVTSTRLVSLAHRSVAAIEYVVEAIEEFVRVTVQSELVTNEDVPE
TSADPRVSAILDRPLQAVEHERTERGALLMHRTRASALMMAAGMEHEVEVPGRVEITTDA
RPDLARTTVICGLRPGQKLRIVKYLAYGWSSLRSRPALRDQAAGALHGARYSGWQGLLDA
QRAYLDDFWDSADVEVEGDPECQQAVRFGLFHLLQASARAERRAIPSKGLTGTGYDGHAF
WDTEGFVLPVLTYTAPHAVADALRWRASTLDLAKERAAELGLEGAAFPWRTIRGQESSAY
WPAGTAAWHINADIAMAFERYRIVTGDGSLEEECGLAVLIETARLWLSLGHHDRHGVWHL
DGVTGPDEYTAVVRDNVFTNLMAAHNLHTAADACLRHPEAAEAMGVTTEEMAAWRDAADA
ANIPYDEELGVHQQCEGFTTLAEWDFEANTTYPLLLHEAYVRLYPAQVIKQADLVLAMQW
QSHAFTPEQKARNVDYYERRMVRDSSLSACTQAVMCAEVGHLELAHDYAYEAALIDLRDL
HRNTRDGLHMASLAGAWTALVVGFGGLRDDEGILSIDPQLPDGISRLRFRLRWRGFRLIV
DANHTDVTFILGDGPGTQLTMRHAGQDLTLHTDTPSTIAVRTRKPLLPPPPQPPGREPVH
RRALAR
NT seq 2361 nt NT seq  +upstreamnt  +downstreamnt
atgatcaccgaggacgccttccccgtcgaaccgtggcaggtccgcgagaccaagctcaac
ctgaacctgctggcccagtccgaatccctattcgccttgtccaacgggcacattggatta
cgcggcaacctcgacgagggcgaacccttcggactgccgggcacctacctgaactctttc
tacgaaatccggccgctgccgtacgccgaggccggttatggatatccggaggccggccag
accgttgtcgacgtcaccaacggcaagatctttcgcctgttggtcggcgacgagccgttc
gacgtccggtatggcgaattgatctcccacgaacggatcctcgacctgcgcgccgggacg
ctgacccgccgcgcgcactggcgctcaccggcgggcaagcaagtcaaagtgacgtccacc
cggctggtgtcgctggcccaccgcagcgtcgcggcgatcgagtacgtcgtcgaggcaatc
gaggaattcgttcgcgtgaccgtgcagtccgaactcgtcaccaacgaggacgtaccggag
acctcggccgacccgcgggtgtcggccatcctggacaggccgctacaggccgtcgagcac
gaacgcaccgagcggggtgcacttctcatgcaccgcacccgagccagcgcgctgatgatg
gccgcagggatggaacacgaggtcgaggttcccgggcgggtcgagatcaccaccgacgcc
cgcccggacctggcccgaaccaccgtgatctgcgggctgcgcccgggacagaagctgcgc
atcgtcaaatacctggcctatggctggtccagcctgcgctcccgcccggcgctgcgcgac
caggccgccggcgcgctgcacggtgcccgctacagcggctggcaggggctgctggacgcg
caacgcgcctacctcgacgacttctgggacagcgcggacgtggaggtcgagggcgacccg
gaatgtcagcaagcggtgcgtttcgggttatttcacctgttgcaggccagcgcgcgcgcc
gaacgccgcgcgatccccagcaaggggctcaccggaaccgggtatgacggccacgccttt
tgggacaccgaaggtttcgtgctaccggtgctcacctacaccgcaccgcatgcggtcgcc
gacgcgctgcggtggcgggcgtcgacgttggacctggccaaggagcgggcggccgagctc
ggcctggaaggtgccgcctttccctggcggaccatccgcggacaggagtcctcggcctac
tggccggccggcacggcggcctggcacatcaacgccgacatcgcgatggcgttcgagcgg
taccgcatcgtcaccggcgacggttcgctggaggaggaatgcggccttgcggtgctgatc
gagaccgcccggctgtggctctcgctcgggcaccacgaccgccacggcgtctggcacctc
gacggggtcaccggtcccgacgagtacacggcggtcgtccgcgacaacgtgttcacgaat
ctgatggcggcgcacaatctgcacaccgccgccgatgcttgcttgcgccaccccgaggcg
gcggaggccatgggtgtcaccaccgaggagatggccgcctggcgcgacgcggccgacgcc
gccaacattccctacgacgaggaactcggtgtccaccagcagtgtgaagggttcaccacc
cttgcggagtgggatttcgaagccaacaccacttatccgttgctactgcacgaggcctac
gtgcgcttgtatcccgcacaggtgatcaagcaggccgacctggtgctggcgatgcagtgg
cagagtcacgcgttcacgcccgagcagaaggcgcgcaacgtcgactactacgaacggcgc
atggtgcgcgactcgtcgttgtcggcctgcactcaggcggtgatgtgcgccgaggtcggc
catctcgagttggcccacgactatgcctacgaagccgccctgatcgacctgcgcgacctg
caccgcaacacccgtgacggcctacacatggcttcgctggccggagcctggacggcgctg
gtcgtaggcttcggcggcctacgcgacgacgagggcatcctgtccatcgatccgcagctg
cccgacggcatctcgcggctgcggttccggctgcgatggcgcggcttccggctgatcgtc
gacgccaaccacaccgacgtcaccttcatccttggcgacggtcccggcacccagctgacc
atgcgccacgccggccaagatctgacgctgcacacggacacaccgtccaccatcgccgtg
cgcacccgtaagccgctgctgccgccaccaccgcagccgccaggccgcgagccagtgcac
cgccgggctttagcccggtga

DBGET integrated database retrieval system