KEGG   Mycobacterium tuberculosis H37Rv: Rv3423cHelp
Entry
Rv3423c           CDS       T00015                                 

Gene name
alr
Definition
(RefSeq) alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    Rv3423c (alr)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    Rv3423c (alr)
Enzymes [BR:mtu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Rv3423c (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:mtu01011]
 Precursor biosynthesis
  Racemase
   Rv3423c (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(3840194..3841420)
Genome map
AA seq 408 aa AA seqDB search
MKRFWENVGKPNDTTDGRGTTSLAMTPISQTPGLLAEAMVDLGAIEHNVRVLREHAGHAQ
LMAVVKADGYGHGATRVAQTALGAGAAELGVATVDEALALRADGITAPVLAWLHPPGIDF
GPALLADVQVAVSSLRQLDELLHAVRRTGRTATVTVKVDTGLNRNGVGPAQFPAMLTALR
QAMAEDAVRLRGLMSHMVYADKPDDSINDVQAQRFTAFLAQAREQGVRFEVAHLSNSSAT
MARPDLTFDLVRPGIAVYGLSPVPALGDMGLVPAMTVKCAVALVKSIRAGEGVSYGHTWI
APRDTNLALLPIGYADGVFRSLGGRLEVLINGRRCPGVGRICMDQFMVDLGPGPLDVAEG
DEAILFGPGIRGEPTAQDWADLVGTIHYEVVTSPRGRITRTYREAENR
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacggttctgggagaatgtcggaaagccaaacgacacgacagatgggcggggcacg
acttcgttggccatgacaccgatatcccagacacctggcctcctcgccgaggccatggtg
gatctgggcgctattgaacacaacgtgcgggtgctgcgtgagcacgccggccacgcgcag
ctgatggcggtggtcaaggccgacggctacggtcacggtgctacgcgcgtcgcccaaacc
gccctgggagccggtgcggccgaactcggcgtcgccaccgtcgacgaggcgctagcgctg
cgcgctgatggcattaccgcaccggtgctggcctggctgcatccgcccggcatcgacttc
gggcccgcgctgctggccgacgtgcaggtcgcggtgtcctcgctgcgccaactcgacgaa
ctgttgcacgcggtgcgccggaccggccggacggcgacggtgaccgtcaaggtggatacc
gggctgaaccgcaatggcgtgggaccggcacaattcccggccatgctgaccgcgttacgc
caagccatggccgaggacgccgtccggctgcgggggctgatgtcgcatatggtttacgcc
gacaagcctgacgattccatcaacgatgttcaggcccaacggtttaccgcctttctggcg
caggcccgcgaacaaggggtgcggttcgaggtggcgcatctatcgaactcatcagcaact
atggcgcgccccgacctgacgttcgacctggtgcggccgggcatcgcggtgtatgggcta
agcccggtacccgccctcggtgacatggggctggtgccggcgatgaccgtgaaatgtgct
gttgcgctggtgaaatcgattcgtgcgggggagggcgtgtcgtatgggcacacatggatc
gcgccacgcgacaccaatctggcgctgctgccgatcggttacgcagacggcgtgttccgg
tcgctgggcgggcggctggaggtgctgatcaacggcagacgatgccccggtgtggggcgg
atctgcatggaccagttcatggtcgacctgggccccgggccgcttgatgtggccgaaggc
gacgaggcgattttgttcgggccgggcatccggggtgagcccacggctcaggactgggcc
gatcttgtcggcaccatccactacgaagtggtcaccagcccgcgaggacgtatcaccagg
acctatcgcgaggctgaaaaccgttga

DBGET integrated database retrieval system