KEGG   Mycobacterium tuberculosis H37Rv: Rv3436cHelp
Entry
Rv3436c           CDS       T00015                                 

Gene name
glmS
Definition
(RefSeq) glucosamine--fructose-6-phosphate aminotransferase
  KO
K00820  
glucosamine--fructose-6-phosphate aminotransferase (isomerizing) [EC:2.6.1.16]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Alanine, aspartate and glutamate metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Rv3436c (glmS)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Rv3436c (glmS)
Enzymes [BR:mtu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.16  glutamine---fructose-6-phosphate transaminase (isomerizing)
     Rv3436c (glmS)
Peptidases [BR:mtu01002]
 Cysteine Peptidases
  Family C44
   Rv3436c (glmS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Position
complement(3855015..3856889)
Genome map
AA seq 624 aa AA seqDB search
MCGIVGYVGRRPAYVVVMDALRRMEYRGYDSSGIALVDGGTLTVRRRAGRLANLEEAVAE
MPSTALSGTTGLGHTRWATHGRPTDRNAHPHRDAAGKIAVVHNGIIENFAVLRRELETAG
VEFASDTDTEVAAHLVARAYRHGETADDFVGSVLAVLRRLEGHFTLVFANADDPGTLVAA
RRSTPLVLGIGDNEMFVGSDVAAFIEHTREAVELGQDQAVVITADGYRISDFDGNDGLQA
GRDFRPFHIDWDLAAAEKGGYEYFMLKEIAEQPAAVADTLLGHFVGGRIVLDEQRLSDQE
LREIDKVFVVACGTAYHSGLLAKYAIEHWTRLPVEVELASEFRYRDPVLDRSTLVVAISQ
SGETADTLEAVRHAKEQKAKVLAICNTNGSQIPRECDAVLYTRAGPEIGVASTKTFLAQI
AANYLLGLALAQARGTKYPDEVEREYHELEAMPDLVARVIAATGPVAELAHRFAQSSTVL
FLGRHVGYPVALEGALKLKELAYMHAEGFAAGELKHGPIALIEDGLPVIVVMPSPKGSAT
LHAKLLSNIREIQTRGAVTIVIAEEGDETVRPYADHLIEIPAVSTLLQPLLSTIPLQVFA
ASVARARGYDVDKPRNLAKSVTVE
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
gtgtgcggaattgtcggttacgtcgggcggcgccccgcctacgtcgtcgtcatggacgcg
ctgcgccggatggagtaccgcggctacgactcgtcgggcatcgcgctggtcgacggtggc
acactcaccgtgcgccggcgtgcgggccggctggccaacctcgaggaagccgtggcggaa
atgccgtccacggcgctgtccggtactaccggcctgggccacacccgctgggccacccac
ggtcgtcccaccgaccgcaacgcgcacccgcaccgcgacgctgccggcaagatcgccgtc
gtccacaacggcatcatcgagaacttcgccgtcttgcgccgggagctggagactgccggt
gtcgagtttgccagcgacaccgataccgaggtcgcggcgcacctggtggcgcgggcgtat
cggcacggcgagacggccgatgacttcgtcggctccgtacttgccgtgctgcgccggctt
gaggggcatttcacgctcgtgttcgccaatgccgacgaccccggcaccctcgtggcggcc
cgccgttccacgcccctggtgctgggcatcggcgacaacgagatgttcgtcggttccgac
gtggccgcgtttatcgagcacacccgggaagcggtcgagctcggccaggaccaggcggtg
gtgatcaccgccgacggctaccggatcagcgatttcgacggcaacgatggcctacaagct
gggcgcgatttccgccccttccacatcgactgggatctggctgccgccgaaaagggcggc
tacgagtacttcatgctcaaggagatcgccgagcagcccgccgcggtggccgacaccttg
ctcggacacttcgtgggtggccggatcgtgctcgacgagcagcggttgagcgaccaggaa
ctgcgcgagatcgacaaggtgttcgtggtggcctgcggtaccgcatatcactccgggctg
ctggccaagtacgcgatcgagcactggacgcggctgcccgtggaagtggaactcgccagc
gagtttcggtatcgggatccggtgttggaccgtagcaccttggtggtggcgatctcgcag
tccggggaaaccgccgacacgctggaagcggtccgacacgccaaggagcagaaagccaag
gtgctggcgatctgcaacaccaacggctcgcagatcccgcgcgagtgcgacgcggtgctc
tacacccgcgccggcccggagatcggtgtggcgtccacaaaaacgtttctggcgcagatt
gctgccaactatctgctcggccttgccttggcgcaggcccgcggcaccaaataccccgac
gaggtcgagcgcgagtaccacgaactggaagcgatgccggacctggtggcccgggtgatc
gcggcgaccggaccggtggccgagctggcccaccggttcgcccagtcgtcgaccgtgctg
ttcctgggtcgccatgtcggctatccggtggcgctggagggtgcactcaaactcaaggag
ttggcctacatgcacgccgagggtttcgcggccggcgagctcaagcacggcccgatcgcg
ctgatcgaagacggcctaccggtcatcgtcgtcatgccctcacccaaggggtcggccacg
ctgcacgccaagctgctgtccaacatccgtgaaatccagacccgcggtgcggtgaccatc
gtgatcgccgaggagggcgacgaaacggtgcgcccctacgccgatcacctgatcgaaatc
ccagcggtgtcaacgctattgcagccgctgctatcaaccattccgcttcaggtgttcgcg
gcttcggtggcgcgcgcccgcggctacgatgtcgacaagccgcggaatctggccaagtcc
gtcaccgtcgaatag

DBGET integrated database retrieval system