KEGG   Mycobacterium tuberculosis H37Rv: Rv3464Help
Entry
Rv3464            CDS       T00015                                 

Gene name
rmlB
Definition
(RefSeq) dTDP-glucose 4,6-dehydratase
  KO
K01710  
dTDP-glucose 4,6-dehydratase [EC:4.2.1.46]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Acarbose and validamycin biosynthesis
Biosynthesis of antibiotics
Module
dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Rv3464 (rmlB)
   01055 Biosynthesis of vancomycin group antibiotics
    Rv3464 (rmlB)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Rv3464 (rmlB)
   00525 Acarbose and validamycin biosynthesis
    Rv3464 (rmlB)
Enzymes [BR:mtu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.46  dTDP-glucose 4,6-dehydratase
     Rv3464 (rmlB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
3881837..3882832
Genome map
AA seq 331 aa AA seqDB search
MRLLVTGGAGFIGTNFVHSAVREHPDDAVTVLDALTYAGRRESLADVEDAIRLVQGDITD
AELVSQLVAESDAVVHFAAESHVDNALDNPEPFLHTNVIGTFTILEAVRRHGVRLHHIST
DEVYGDLELDDRARFTESTPYNPSSPYSATKAGADMLVRAWVRSYGVRATISNCSNNYGP
YQHVEKFIPRQITNVLTGRRPKLYGAGANVRDWIHVDDHNSAVRRILDRGRIGRTYLISS
EGERDNLTVLRTLLRLMDRDPDDFDHVTDRVGHDLRYAIDPSTLYDELCWAPKHTDFEEG
LRTTIDWYRDNESWWRPLKDATEARYQERGQ
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgcggttgctagtcaccggtggcgcgggattcatcggcacgaatttcgtgcacagcgcc
gtacgtgagcatccagacgatgcggttaccgtactcgacgccctgacctacgccggccgg
cgcgagtcgctggccgacgtggaggatgccatccggctggttcagggcgatatcaccgac
gccgagctggtttcgcagctggtggccgagtccgacgcggtggtgcattttgccgccgaa
tcccatgtcgacaatgcactggacaatccggagccgtttctgcacaccaacgtcatcggg
accttcaccatcctggaagcggtgcgacgccacggtgtgcgcctgcaccacatctccacc
gacgaggtctacggcgacttggagctcgacgaccgggcgcggttcaccgaatcgacgccc
tataacccgtccagcccttactcggcgaccaaggcgggcgcagacatgttggtccgggcc
tgggttcggtcctatggcgtacgcgcgacgatctccaactgctccaacaactacgggccg
tatcagcacgtcgagaagttcattccgcgtcagatcaccaatgtgctcaccgggcggcgg
cccaagctctacggcgcgggcgccaatgtccgtgactggatccacgtcgacgaccacaac
agcgcggtgcggcgaatcctggacagaggccgcatcggccgaacctacctgatcagctcc
gagggcgagcgtgacaacctgaccgtgctgcgcacgctgctgcgactgatggaccgcgat
ccggacgacttcgaccacgtcaccgaccgcgtcggccacgacctgcgctatgccatcgac
ccgtccacgctctacgacgaattatgctgggcgccaaagcataccgatttcgaggagggc
ctgcggaccacgatcgactggtaccgcgacaacgaatcgtggtggcgtccactaaaagac
gccacggaggcccgctatcaagaacgcggtcaatga

DBGET integrated database retrieval system