KEGG   Mycobacterium tuberculosis H37Rv: Rv3490Help
Entry
Rv3490            CDS       T00015                                 

Gene name
otsA
Definition
(RefSeq) trehalose-phosphate synthase
  KO
K00697  
trehalose 6-phosphate synthase [EC:2.4.1.15]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Rv3490 (otsA)
Enzymes [BR:mtu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.15  alpha,alpha-trehalose-phosphate synthase (UDP-forming)
     Rv3490 (otsA)
Glycosyltransferases [BR:mtu01003]
 Others
  Trehalose
   Rv3490 (otsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
3908236..3909738
Genome map
AA seq 500 aa AA seqDB search
MAPSGGQEAQICDSETFGDSDFVVVANRLPVDLERLPDGSTTWKRSPGGLVTALEPVLRR
RRGAWVGWPGVNDDGAEPDLHVLDGPIIQDELELHPVRLSTTDIAQYYEGFSNATLWPLY
HDVIVKPLYHREWWDRYVDVNQRFAEAASRAAAHGATVWVQDYQLQLVPKMLRMLRPDLT
IGFFLHIPFPPVELFMQMPWRTEIIQGLLGADLVGFHLPGGAQNFLILSRRLVGTDTSRG
TVGVRSRFGAAVLGSRTIRVGAFPISVDSGALDHAARDRNIRRRAREIRTELGNPRKILL
GVDRLDYTKGIDVRLKAFSELLAEGRVKRDDTVVVQLATPSRERVESYQTLRNDIERQVG
HINGEYGEVGHPVVHYLHRPAPRDELIAFFVASDVMLVTPLRDGMNLVAKEYVACRSDLG
GALVLSEFTGAAAELRHAYLVNPHDLEGVKDGIEEALNQTEEAGRRRMRSLRRQVLAHDV
DRWAQSFLDALAGAHPRGQG
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggctccctcgggaggccaggaggcgcagatttgcgattcggagaccttcggggactct
gacttcgtggtggtagccaatcgactgcccgtcgatctggagcgtcttcccgacggcagc
acaacctggaaacgcagccccggaggcttggtcaccgccttggagccggtgctgcggcgt
cggcgcggggcctgggtcggctggcccggcgttaacgacgacggggccgaacccgacctc
cacgtgctggacggccccatcatccaagacgagctggaacttcatccggtacggctgagc
accacggacatagctcagtactacgagggattctccaacgccacactgtggccgctgtac
cacgacgtcatcgtcaagccgctctaccaccgcgaatggtgggatcgctacgtcgacgtc
aaccagcgctttgccgaggccgcgtcgcgcgccgccgcccacggcgcaaccgtgtgggta
caggactaccagctgcagctggtaccgaagatgctgcgcatgctgcggcccgatctgacc
atcggtttctttttgcacatcccgttcccgccggtagagctgtttatgcagatgccgtgg
cgcaccgagatcatccagggcctactgggcgccgacctggtgggcttccatcttccgggc
ggtgcccagaatttcctgatcctgtcccggcgtctggtcggcaccgacacttcccgcgga
accgtcggtgtgcggtcgcggttcggtgcggcggtgctcgggtcccgcaccatacgagtt
ggcgcctttcctatctcggttgactccggcgcgctcgaccacgctgcccgcgaccgcaac
atcaggcgccgggcccgcgagattcgcaccgaactgggaaatccgcgcaagatcctgctc
ggtgttgaccggctcgactacaccaagggcatcgacgtacggctgaaggccttttccgag
ctgctggccgagggccgcgtcaaacgcgacgacaccgtcgtggtccagctggctaccccg
agccgcgagcgggtggagagctaccagacgctgcgcaacgacatcgaacgccaggtcggc
cacattaacggcgagtacggtgaggttggccatccggtagtgcattacctgcatcgaccg
gctccgcgcgacgagcttatcgctttcttcgtggccagcgacgtcatgctggtcacccca
ctacgcgacgggatgaacctggtggccaaggagtacgtcgcttgccgcagcgatcttggc
ggtgccctggtgctcagcgaattcaccggggccgcagccgaactccggcacgcatacctg
gtcaacccgcacgacctggaaggcgtcaaggacgggatagaggaagcgctcaaccagacg
gaggaggcgggccggcggcgaatgcggtcgctgcgacgccaagtgctcgcccacgacgtg
gaccgctgggcacagtcgtttctcgacgctctcgccggggcacacccgaggggccaaggc
taa

DBGET integrated database retrieval system