KEGG   Mycobacterium tuberculosis H37Rv: Rv3502cHelp
Entry
Rv3502c           CDS       T00015                                 

Gene name
hsd4A
Definition
(RefSeq) 3-oxoacyl-ACP reductase
  KO
K00059  
3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Fatty acid biosynthesis
Biotin metabolism
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Rv3502c (hsd4A)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    Rv3502c (hsd4A)
   01040 Biosynthesis of unsaturated fatty acids
    Rv3502c (hsd4A)
  Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Rv3502c (hsd4A)
  Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosyntheses
    Rv3502c (hsd4A)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.100  3-oxoacyl-[acyl-carrier-protein] reductase
     Rv3502c (hsd4A)
Lipid biosynthesis proteins [BR:mtu01004]
 Fatty acid synthase
  Component type
   Rv3502c (hsd4A)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
complement(3921087..3922040)
Genome map
AA seq 317 aa AA seqDB search
MKLTESNRSPRTTNTTDLSGKVAVVTGAAAGLGRAEALGLARLGATVVVNDVASALDASD
VVDEIGAAAADAGAKAVAVAGDISQRATADELLASAVGLGGLDIVVNNAGITRDRMLFNM
SDEEWDAVIAVHLRGHFLLTRNAAAYWRDKAKDAEGGSVFGRLVNTSSEAGLVGPVGQAN
YAAAKAGITALTLSAARALGRYGVCANVICPRARTAMTADVFGAAPDVEAGQIDPLSPQH
VVSLVQFLASPAAAEVNGQVFIVYGPQVTLVSPPHMERRFSADGTSWDPTELTATLRDYF
AGRDPEQSFSATDLMRQ
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
ttgaaattgactgagtccaatcgctcgccgcgtaccacgaacacgaccgatctgtccgga
aaggtggcggtggtcaccggcgcggccgcgggtttgggtcgggccgaagcgctcggcctg
gcccggttgggcgccaccgtcgtcgtcaacgatgttgcttccgccctggatgcttccgac
gtcgtcgacgagatcggcgccgccgctgccgatgctggtgctaaggccgtcgcggtagcc
ggtgatatcagccagcgcgcgacggccgacgaactgctcgccagcgccgtcgggctgggc
ggactggacatcgtggtgaacaatgccggcatcacccgcgaccggatgctgttcaacatg
tccgacgaggagtgggacgccgtgatcgcggtgcacctgcgcggccattttctgctcacc
cgcaacgccgctgcctactggcgggacaaagccaaggatgccgaagggggatcggtcttc
ggccggctcgtcaacacctcgtcggaggcgggtctggtgggcccggtggggcaggcgaat
tacgccgccgccaaggctggcatcaccgcgctaaccctgtcggcggcgcgggcgctcggg
cgctacggcgtttgcgccaatgtgatttgtccgcgggcgcgcaccgcgatgacggccgat
gtcttcggcgccgcacccgatgtcgaagcgggccagatcgacccgctgtcgccgcagcat
gtggtaagcctggtccagtttctggcgtccccggctgccgcggaagtcaacggtcaggtg
ttcatcgtctacggtccgcaggtgacgctggtgtcaccgccgcacatggagcgccggttc
agcgcggacggcacgtcctgggatcccaccgagctcaccgcgacgctgcgggactacttt
gctggtcgggatccggaacagagcttttcggcgaccgatctgatgcgtcagtga

DBGET integrated database retrieval system