KEGG   Mycobacterium tuberculosis H37Rv: Rv3509cHelp
Entry
Rv3509c           CDS       T00015                                 

Gene name
ilvX
Definition
(RefSeq) acetohydroxyacid synthase large subunit
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00290  Valine, leucine and isoleucine biosynthesis
mtu00650  Butanoate metabolism
mtu00660  C5-Branched dibasic acid metabolism
mtu00770  Pantothenate and CoA biosynthesis
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01130  Biosynthesis of antibiotics
mtu01210  2-Oxocarboxylic acid metabolism
mtu01230  Biosynthesis of amino acids
Module
mtu_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
mtu_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Rv3509c (ilvX)
   00660 C5-Branched dibasic acid metabolism
    Rv3509c (ilvX)
  Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    Rv3509c (ilvX)
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Rv3509c (ilvX)
Enzymes [BR:mtu01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     Rv3509c (ilvX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_C
Motif
Other DBs
NCBI-GeneID: 888267
NCBI-ProteinID: NP_218026
TubercuList: Rv3509c
UniProt: O53554 I6YCA7
Position
complement(3936877..3938424)
Genome map
AA seq 515 aa AA seqDB search
MNGAQALINTLVDGGVDVCFANPGTSEMHFVAALDAVPRMRGMLTLFEGVATGAADGYAR
IAGRPAAVLLHLGPGLGNGLANLHNARRARVPMVVVVGDHATYHKKYDAPLESDIDAVAG
TVSGWVRRTEAAADVGADAEAAIAASRSGSQIATLILPADVCWSDGAHAAAGVPAQAAAA
PVDVGPVAGVLRSGEPAMMLIGGDATRGPGLTAAARIVQATGARWLCETFPTCLERGAGI
PAVERLAYFAEGAAAQLDGVKHLVLAGARSPVSFFAYPGMPSDLVPAGCEVHVLAEPGGA
ADALAALADEVAPGTVAPVAGASRPQLPTGDLTSVSAADVVGALLPERAIVVDESNTCGV
LLPQATAGAPAHDWLTLTGGAIGYGIPAAVGAAVAAPDRPVLCLESDGSAMYTISGLWSQ
ARENLDVTTVIYNNGAYDILRIELQRVGAGSDPGPKALDLLDISRPTMDFVKIAEGMGVP
ARRVTTCEEFADALRAAFAEPGPHLIDVVVPSLVG
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
gtgaacggtgctcaggccctgatcaacaccctggtcgacgggggtgtcgatgtgtgcttc
gccaaccctggcacgtcggaaatgcatttcgtggcggcgctagacgccgtcccgcgcatg
cgtggcatgctgaccctgttcgaaggcgtggctaccggggccgccgacggttatgcccgc
attgctggccggccggcggcggtgctgctgcatctgggccccggactgggcaacggcctg
gccaacctgcacaacgcgcgccgtgcccgggtgccgatggtggtggttgtcggagaccac
gcgacttaccacaagaagtacgacgccccgctggaatccgatatcgatgcggtcgctggc
accgtttcgggatgggtgcgccggacggaggctgccgccgacgtcggggccgacgctgaa
gcggccattgcggccagccggtcaggttcacagatcgcgacgctgattctgcccgcggat
gtgtgttggagcgacggtgcccacgcggccgcgggcgtgccggctcaggcggcggcggcg
ccagtggacgtggggccggtggctggggtgctgcgctcaggggaacccgccatgatgctg
atcggtggggatgccacccgcgggccggggctgaccgcggctgcgcggatcgtgcaggca
accggggcccgttggttatgcgagacgtttccgacgtgcctggaacgtggcgccggtatc
cccgccgtcgaacggctggcctatttcgctgaaggtgccgcggcccagctggacggggtc
aaacatctcgtgctggccggggccaggtcgccggtgtcgtttttcgcctacccgggtatg
cccagtgacctggtgccggccggttgtgaggtgcacgtgcttgccgaacccggtggtgcg
gccgacgcactggccgcgttggccgacgaggtagcgcccgggacggttgccccggtggcg
ggcgcgtcacgtccgcagctgccgacgggtgacctgacgtcggtgtcggcggccgatgtg
gtcggtgcgttgctgccggaacgggcgattgttgtcgacgagtcgaatacttgtggtgtc
ctgctgccgcaggccaccgccggggccccggcccatgactggcttacgctgaccggcggg
gcaatcggttacggcatcccggctgcggtcggtgccgcggtcgccgcgcccgaccgcccg
gtgttgtgcctggaatccgacgggtcggcaatgtacacgatttcaggattgtggagccaa
gcgcgggagaacctcgacgtcaccaccgtcatctacaacaacggcgcctacgacattctg
cggatcgagctgcaacgtgtcggcgcggggtcggatcctggcccgaaggccctggatctc
cttgatatatcgcgtcccacaatggatttcgtcaagatcgccgaaggtatgggtgttcct
gcacgtcgtgtcaccacctgcgaggaattcgccgacgccctgcgcgcggccttcgccgag
cccgggccgcatctgatcgatgtagtggtgccatcgcttgtggggtag

DBGET integrated database retrieval system