KEGG   Mycobacterium tuberculosis H37Rv: Rv3509cHelp
Entry
Rv3509c           CDS       T00015                                 

Gene name
ilvX
Definition
(RefSeq) acetohydroxyacid synthase large subunit
  KO
K01652  
acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Valine, leucine and isoleucine biosynthesis
Butanoate metabolism
C5-Branched dibasic acid metabolism
Pantothenate and CoA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    Rv3509c (ilvX)
   01230 Biosynthesis of amino acids
    Rv3509c (ilvX)
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Rv3509c (ilvX)
   00660 C5-Branched dibasic acid metabolism
    Rv3509c (ilvX)
  Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    Rv3509c (ilvX)
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Rv3509c (ilvX)
Enzymes [BR:mtu01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     Rv3509c (ilvX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
complement(3936877..3938424)
Genome map
AA seq 515 aa AA seqDB search
MNGAQALINTLVDGGVDVCFANPGTSEMHFVAALDAVPRMRGMLTLFEGVATGAADGYAR
IAGRPAAVLLHLGPGLGNGLANLHNARRARVPMVVVVGDHATYHKKYDAPLESDIDAVAG
TVSGWVRRTEAAADVGADAEAAIAASRSGSQIATLILPADVCWSDGAHAAAGVPAQAAAA
PVDVGPVAGVLRSGEPAMMLIGGDATRGPGLTAAARIVQATGARWLCETFPTCLERGAGI
PAVERLAYFAEGAAAQLDGVKHLVLAGARSPVSFFAYPGMPSDLVPAGCEVHVLAEPGGA
ADALAALADEVAPGTVAPVAGASRPQLPTGDLTSVSAADVVGALLPERAIVVDESNTCGV
LLPQATAGAPAHDWLTLTGGAIGYGIPAAVGAAVAAPDRPVLCLESDGSAMYTISGLWSQ
ARENLDVTTVIYNNGAYDILRIELQRVGAGSDPGPKALDLLDISRPTMDFVKIAEGMGVP
ARRVTTCEEFADALRAAFAEPGPHLIDVVVPSLVG
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
gtgaacggtgctcaggccctgatcaacaccctggtcgacgggggtgtcgatgtgtgcttc
gccaaccctggcacgtcggaaatgcatttcgtggcggcgctagacgccgtcccgcgcatg
cgtggcatgctgaccctgttcgaaggcgtggctaccggggccgccgacggttatgcccgc
attgctggccggccggcggcggtgctgctgcatctgggccccggactgggcaacggcctg
gccaacctgcacaacgcgcgccgtgcccgggtgccgatggtggtggttgtcggagaccac
gcgacttaccacaagaagtacgacgccccgctggaatccgatatcgatgcggtcgctggc
accgtttcgggatgggtgcgccggacggaggctgccgccgacgtcggggccgacgctgaa
gcggccattgcggccagccggtcaggttcacagatcgcgacgctgattctgcccgcggat
gtgtgttggagcgacggtgcccacgcggccgcgggcgtgccggctcaggcggcggcggcg
ccagtggacgtggggccggtggctggggtgctgcgctcaggggaacccgccatgatgctg
atcggtggggatgccacccgcgggccggggctgaccgcggctgcgcggatcgtgcaggca
accggggcccgttggttatgcgagacgtttccgacgtgcctggaacgtggcgccggtatc
cccgccgtcgaacggctggcctatttcgctgaaggtgccgcggcccagctggacggggtc
aaacatctcgtgctggccggggccaggtcgccggtgtcgtttttcgcctacccgggtatg
cccagtgacctggtgccggccggttgtgaggtgcacgtgcttgccgaacccggtggtgcg
gccgacgcactggccgcgttggccgacgaggtagcgcccgggacggttgccccggtggcg
ggcgcgtcacgtccgcagctgccgacgggtgacctgacgtcggtgtcggcggccgatgtg
gtcggtgcgttgctgccggaacgggcgattgttgtcgacgagtcgaatacttgtggtgtc
ctgctgccgcaggccaccgccggggccccggcccatgactggcttacgctgaccggcggg
gcaatcggttacggcatcccggctgcggtcggtgccgcggtcgccgcgcccgaccgcccg
gtgttgtgcctggaatccgacgggtcggcaatgtacacgatttcaggattgtggagccaa
gcgcgggagaacctcgacgtcaccaccgtcatctacaacaacggcgcctacgacattctg
cggatcgagctgcaacgtgtcggcgcggggtcggatcctggcccgaaggccctggatctc
cttgatatatcgcgtcccacaatggatttcgtcaagatcgccgaaggtatgggtgttcct
gcacgtcgtgtcaccacctgcgaggaattcgccgacgccctgcgcgcggccttcgccgag
cccgggccgcatctgatcgatgtagtggtgccatcgcttgtggggtag

DBGET integrated database retrieval system