KEGG   Mycobacterium tuberculosis H37Rv: Rv3526Help
Entry
Rv3526            CDS       T00015                                 

Gene name
kshA
Definition
(RefSeq) 3-ketosteroid-9-alpha-monooxygenase oxygenase subunit
  KO
K15982  
3-ketosteroid 9alpha-monooxygenase subunit A [EC:1.14.13.142]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Steroid degradation
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    Rv3526 (kshA)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.142  3-ketosteroid 9alpha-monooxygenase
     Rv3526 (kshA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
3962439..3963599
Genome map
AA seq 386 aa AA seqDB search
MSTDTSGVGVREIDAGALPTRYARGWHCLGVAKDYLEGKPHGVEAFGTKLVVFADSHGDL
KVLDGYCRHMGGDLSEGTVKGDEVACPFHDWRWGGDGRCKLVPYARRTPRMARTRSWTTD
VRSGLLFVWHDHEGNPPDPAVRIPEIPEAASDEWTDWRWNRILIEGSNCRDIIDNVTDMA
HFFYIHFGLPTYFKNVFEGHIASQYLHNVGRPDVDDLGTSYGEAHLDSEASYFGPSFMIN
WLHNRYGNYKSESILINCHYPVTQNSFVLQWGVIVEKPKGMSEEMTDKLSRVFTEGVSKG
FLQDVEIWKHKTRIDNPLLVEEDGAVYQLRRWYEQFYVDVADIKPEMVERFEIEVDTKRA
NEFWNAEVEKNLKSREVSDDVPAEQH
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
gtgagtaccgacacgagtggggtcggtgttcgggagatcgatgccggcgccttgccgacc
aggtatgcgcgtggctggcattgcctgggcgtcgcgaaggactatttggaagggaagcca
cacggggtagaggcgttcggcaccaagctggttgtgttcgctgattcccacggggacctg
aaagtcctcgacggctactgccggcacatgggcggcgacctgtccgagggcaccgtcaaa
ggcgacgaggtcgcttgcccgttccacgactggcgctggggtggcgacggccgctgcaaa
ttggtgccgtatgccaggcgcacacccagaatggcgcgcactcggtcgtggacgaccgat
gtgcgcagcgggctgctgtttgtctggcacgaccatgagggcaatccacccgaccccgcg
gtccggatccccgagattcccgaggcggccagcgacgagtggaccgactggcggtggaac
cgcatcctcatcgaagggtccaactgccgcgacatcatcgacaacgtcaccgatatggcg
cacttcttctacatccacttcggtttgccgacgtacttcaagaacgtcttcgagggccac
atcgcctcgcagtatctgcacaacgtgggccggcccgatgtcgacgatctggggacgtct
tacggtgaggcgcatctggattcggaggcgtcttacttcgggccgtcgttcatgatcaac
tggctgcacaaccgctacggcaactacaagtccgagtcgatcctgatcaactgccactac
ccggtgacccagaactcgttcgtcctgcaatggggcgtcatcgtcgaaaagcccaagggt
atgagcgaagagatgaccgacaagttgtcgcgggtgttcaccgagggcgtcagcaagggc
ttcttgcaggatgtcgagatctggaagcacaagacccgcatcgacaacccgctgctggtt
gaagaggacggcgccgtgtatcagctgcgccgctggtatgaacagttttatgtcgacgta
gccgacataaaaccagagatggtggagcgcttcgagatcgaggtcgacaccaagcgcgcc
aacgagttctggaatgccgaggtagagaagaacttgaaatcgagagaagtttccgacgac
gtgcccgccgagcaacactga

DBGET integrated database retrieval system