KEGG   Mycobacterium tuberculosis H37Rv: Rv3565Help
Entry
Rv3565            CDS       T00015                                 

Gene name
aspB
Definition
(RefSeq) aspartate aminotransferase AspB
Organism
mtu  Mycobacterium tuberculosis H37Rv
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Position
4006200..4007366
Genome map
AA seq 388 aa AA seqDB search
MTDRVALRAGVPPFYVMDVWLAAAERQRTHGDLVNLSAGQPSAGAPEPVRAAAAAALHLN
QLGYSVALGIPELRDAIAADYQRRHGITVEPDAVVITTGSSGGFLLAFLACFDAGDRVAM
ASPGYPCYRNILSALGCEVVEIPCGPQTRFQPTAQMLAEIDPPLRGVVVASPANPTGTVI
PPEELAAIASWCDASDVRLISDEVYHGLVYQGAPQTSCAWQTSRNAVVVNSFSKYYAMTG
WRLGWLLVPTVLRRAVDCLTGNFTICPPVLSQIAAVSAFTPEATAEADGNLASYAINRSL
LLDGLRRIGIDRLAPTDGAFYVYADVSDFTSDSLAFCSKLLADTGVAIAPGIDFDTARGG
SFVRISFAGPSGDIEEALRRIGSWLPSQ
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
gtgacggatcgtgtcgccctgcgtgccggcgttcccccgttctacgtgatggacgtctgg
ttggcggccgcggagcgccagcgcacccatggggatctggtgaatctttcggcgggccaa
cccagtgcgggcgctccggaaccggtgcgtgcggccgcggccgccgccctgcatctcaac
cagttgggatactcggtggcgctgggtattccggagctgcgcgacgctatcgccgcggat
taccaacgccggcatggcatcaccgtcgaacccgatgcggtggtgatcaccacgggctcc
tcgggcggctttctgctcgcgtttctggcgtgcttcgacgccggtgatcgggtcgcgatg
gccagtcccggctacccgtgctaccggaatatcctgtcagcgctgggatgtgaggtcgtg
gagatcccgtgcggaccgcagacccgattccaaccgaccgcgcagatgctggccgagatc
gacccaccgctgcgcggtgtcgtcgtcgccagcccggccaacccgaccggaaccgtcatc
ccgcccgaagaactggcggccatcgcgtcgtggtgtgacgcatcggatgtccggttgatc
agtgatgaggtctaccacggcctggtgtaccagggggcaccgcaaaccagctgcgcctgg
cagacgtcgcgaaacgcggtggtagtcaacagcttttccaagtattacgcgatgacgggc
tggcggctgggctggctgctggtgccgacggtgctgcgccgcgcggtggactgcctgacc
ggcaacttcaccatctgcccgccggtcttgtcgcagatcgccgcggtgtccgcgttcacc
ccggaggcgaccgccgaggccgacggcaacctggccagctacgcgatcaaccgctcgctg
ttgctggacggtctgcgtcgcatcggcatcgaccggctggcacccaccgacggcgcattc
tacgtctacgccgacgtctcggacttcaccagcgattcgctggccttctgctcaaagttg
ctggccgacaccggtgttgcgatcgcacccggaatcgatttcgacaccgcacgggggggt
tcgtttgttcggatatcgtttgccgggccaagcggcgacatcgaagaagccttacggcgc
atcggctcctggctgccgagccaatag

DBGET integrated database retrieval system