KEGG   Mycobacterium tuberculosis H37Rv: Rv3582cHelp
Entry
Rv3582c           CDS       T00015                                 

Gene name
ispD
Definition
(RefSeq) 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase
  KO
K00991  
2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [EC:2.7.7.60]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Rv3582c (ispD)
Enzymes [BR:mtu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.60  2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase
     Rv3582c (ispD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(4024344..4025039)
Genome map
AA seq 231 aa AA seqDB search
MVREAGEVVAIVPAAGSGERLAVGVPKAFYQLDGQTLIERAVDGLLDSGVVDTVVVAVPA
DRTDEARQILGHRAMIVAGGSNRTDTVNLALTVLSGTAEPEFVLVHDAARALTPPALVAR
VVEALRDGYAAVVPVLPLSDTIKAVDANGVVLGTPERAGLRAVQTPQGFTTDLLLRSYQR
GSLDLPAAEYTDDASLVEHIGGQVQVVDGDPLAFKITTKLDLLLAQAIVRG
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
gtggtcagggaagcgggcgaagtagttgcgatcgtcccggctgcggggtcgggggagcgg
ttggccgtcggtgtgcccaaggcgttttaccagctcgacgggcagactctcattgagcgg
gccgtcgatggcctgctggattcgggggtagttgacaccgttgttgtggccgtgcccgcc
gaccgtacggacgaggcgaggcagatcctcggccacagggcgatgattgtggcgggtggg
tcgaatcgcactgacaccgtgaacctggcgctgacagtgctgtccgggaccgcggagccg
gagtttgtgcttgtgcatgatgccgcgcgggcactgacaccaccggccctggtcgcccgg
gtggtcgaggcgttgcgggacggttatgccgccgtcgttcccgtactgccgctttctgac
accatcaaggccgtggatgccaacggggtggtcctgggcacgccggaacgagccgggctg
cgggccgtgcagaccccacaagggttcactaccgacctgctgctgcggtcatatcagcgc
ggctccctagaccttccagccgccgagtacaccgatgacgcgtcgctggtcgagcatatc
ggcggccaggtgcaggtggtcgacggcgatccgctggcgttcaagatcaccaccaaactg
gatctgttgctggcccaagctatagtgcgcgggtga

DBGET integrated database retrieval system