KEGG   Mycobacterium tuberculosis H37Rv: Rv3588cHelp
Entry
Rv3588c           CDS       T00015                                 

Gene name
canB
Definition
(RefSeq) carbonic anhydrase
  KO
K01673  
carbonic anhydrase [EC:4.2.1.1]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Nitrogen metabolism
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    Rv3588c (canB)
Enzymes [BR:mtu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.1  carbonic anhydrase
     Rv3588c (canB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(4029871..4030494)
Genome map
AA seq 207 aa AA seqDB search
MPNTNPVAAWKALKEGNERFVAGRPQHPSQSVDHRAGLAAGQKPTAVIFGCADSRVAAEI
IFDQGLGDMFVVRTAGHVIDSAVLGSIEYAVTVLNVPLIVVLGHDSCGAVNAALAAINDG
TLPGGYVRDVVERVAPSVLLGRRDGLSRVDEFEQRHVHETVAILMARSSAISERIAGGSL
AIVGVTYQLDDGRAVLRDHIGNIGEEV
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgcccaacaccaatccggtagccgcgtggaaagcactcaaagagggtaacgagcgattc
gtcgccggccggccccagcatcccagtcagagcgtcgaccaccgagccggcttggccgcc
gggcagaagcccacggcggtgatcttcggctgcgcggacagccgagtggccgctgagatc
atcttcgaccaaggcctgggcgacatgttcgtggtccgcaccgccgggcatgtcatcgac
tcggccgtgctgggctccatagagtacgcggtgaccgtgctcaatgtgccgctcatcgtc
gtcctcggccacgacagctgcggcgccgtgaacgccgctttggccgcgatcaacgacggc
accctgccaggcggctacgtgcgagacgtcgtggaaagggttgcgccgtcggtcctgctc
ggccgccgtgacggtctgagtcgtgtcgacgagttcgagcaacgacatgtacacgagacg
gtggcgatcctcatggcgcgttcatcggccatctcagaacgaatcgcagggggcagcctg
gcgatcgtgggcgtcacctatcaactcgacgatgggcgggctgtactgcgcgaccacatc
ggcaacatcggcgaggaggtctga

DBGET integrated database retrieval system