KEGG   Mycobacterium tuberculosis H37Rv: Rv3601cHelp
Entry
Rv3601c           CDS       T00015                                 

Gene name
panD
Definition
(RefSeq) aspartate 1-decarboxylase
  KO
K01579  
aspartate 1-decarboxylase [EC:4.1.1.11]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
beta-Alanine metabolism
Pantothenate and CoA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Pantothenate biosynthesis, valine/L-aspartate => pantothenate
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Rv3601c (panD)
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Rv3601c (panD)
Enzymes [BR:mtu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.11  aspartate 1-decarboxylase
     Rv3601c (panD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(4043862..4044281)
Genome map
AA seq 139 aa AA seqDB search
MLRTMLKSKIHRATVTCADLHYVGSVTIDADLMDAADLLEGEQVTIVDIDNGARLVTYAI
TGERGSGVIGINGAAAHLVHPGDLVILIAYATMDDARARTYQPRIVFVDAYNKPIDMGHD
PAFVPENAGELLDPRLGVG
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgttacggacgatgctgaagtcgaagatccaccgcgccacggtgacctgcgccgacctg
cactacgtcggctcggtgaccatcgatgccgacttgatggacgccgccgacctgctggaa
ggcgaacaggtaaccatcgtcgatatcgacaacggtgctcgactggtcacctacgcgatc
accggcgaacgcggcagtggtgtgattggcatcaacggtgccgccgcgcacttggtgcat
ccgggggatctggtgattctgattgcgtacgcgacgatggacgacgcccgggcccgcaca
taccagccgcggatcgtgtttgtcgacgcttacaacaaaccgatcgacatgggccacgat
ccggcatttgtgcccgaaaacgcgggcgagctgctagacccccggctcggtgtgggatag

DBGET integrated database retrieval system