KEGG   Mycobacterium tuberculosis H37Rv: Rv3606cHelp
Entry
Rv3606c           CDS       T00015                                 

Gene name
folK
Definition
(RefSeq) 2-amino-4-hydroxy-6-hydroxymethyldihydropteridinepyrophosphokinase
  KO
K00950  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00790  Folate biosynthesis
mtu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Rv3606c (folK)
Enzymes [BR:mtu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Rv3606c (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HPPK
Motif
Other DBs
NCBI-GeneID: 885848
NCBI-ProteinID: NP_218123
TubercuList: Rv3606c
UniProt: P9WNC7 I6XHQ9
Position
complement(4048181..4048747)
Genome map
AA seq 188 aa AA seqDB search
MTRVVLSVGSNLGDRLARLRSVADGLGDALIAASPIYEADPWGGVEQGQFLNAVLIADDP
TCEPREWLRRAQEFERAAGRVRGQRWGPRNLDVDLIACYQTSATEALVEVTARENHLTLP
HPLAHLRAFVLIPWIAVDPTAQLTVAGCPRPVTRLLAELEPADRDSVRLFRPSFDLNSRH
PVSRAPES
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgggtagtgctctcggttggctccaacctgggtgaccgcctggcacgattgcgg
tcggtcgccgacggtctcggcgatgcgttgattgcggcttccccgatatatgaggccgac
ccctggggtggggtggagcaggggcagttcctcaatgcggtgctgatcgccgacgatcct
acctgcgaaccgcgggagtggctgcggcgggcgcaggagttcgagcgcgctgcgggcagg
gtgcgtggccagcgctggggtccacgaaatctcgacgtcgacctgatcgcctgctaccag
acctcggccaccgaggctctggtcgaagtgaccgcgcgggagaaccacctcacgctgccg
cacccactggcgcatctgcgggcctttgtgttgatcccgtggattgccgtcgacccaacg
gcgcagctgacggttgccgggtgcccgcggcccgtcacgcgactgctggccgagctggag
cccgccgaccgcgacagtgtgcggttgtttaggccgtcgttcgatctgaatagcagacac
cccgtcagtcgggcaccggaaagctga

DBGET integrated database retrieval system