KEGG   Mycobacterium tuberculosis H37Rv: Rv3607cHelp
Entry
Rv3607c           CDS       T00015                                 

Gene name
folB
Definition
(RefSeq) dihydroneopterin aldolase
  KO
K01633  
dihydroneopterin aldolase / 7,8-dihydroneopterin epimerase [EC:4.1.2.25 5.1.99.8]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Rv3607c (folB)
Enzymes [BR:mtu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.25  dihydroneopterin aldolase
     Rv3607c (folB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.99  Acting on other compounds
    5.1.99.8  7,8-dihydroneopterin epimerase
     Rv3607c (folB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(4048744..4049145)
Genome map
AA seq 133 aa AA seqDB search
MADRIELRGLTVHGRHGVYDHERVAGQRFVIDVTVWIDLAEAANSDDLADTYDYVRLASR
AAEIVAGPPRKLIETVGAEIADHVMDDQRVHAVEVAVHKPQAPIPQTFDDVAVVIRRSRR
GGRGWVVPAGGAV
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atggctgaccgaatcgaactgcgcggcctgaccgtgcatggtcggcacggggtctacgac
cacgagcgagtggccgggcagcggtttgtcatcgatgtcaccgtgtggatagacctggcc
gaggccgccaacagcgacgacttggccgacacctatgactacgtgcggctggcttcgcgg
gcggccgagatcgtcgccggacccccgcggaagctgatcgaaacggtcggggccgagatc
gctgatcacgtgatggacgaccagcgagtgcatgccgttgaggtggcggtacacaagccg
caggcgcccattccgcagacgttcgacgatgtggcggtggtgatccgacgctcacggcgc
ggcggccgcggttgggtagtcccggcgggcggcgcggtatga

DBGET integrated database retrieval system