KEGG   Mycobacterium tuberculosis H37Rv: Rv3708cHelp
Entry
Rv3708c           CDS       T00015                                 

Gene name
asd
Definition
(RefSeq) aspartate-semialdehyde dehydrogenase
  KO
K00133  aspartate-semialdehyde dehydrogenase [EC:1.2.1.11]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00260  Glycine, serine and threonine metabolism
mtu00261  Monobactam biosynthesis
mtu00270  Cysteine and methionine metabolism
mtu00300  Lysine biosynthesis
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01120  Microbial metabolism in diverse environments
mtu01130  Biosynthesis of antibiotics
mtu01210  2-Oxocarboxylic acid metabolism
mtu01230  Biosynthesis of amino acids
Module
mtu_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
mtu_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rv3708c (asd)
   00270 Cysteine and methionine metabolism
    Rv3708c (asd)
   00300 Lysine biosynthesis
    Rv3708c (asd)
  Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    Rv3708c (asd)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.11  aspartate-semialdehyde dehydrogenase
     Rv3708c (asd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Semialdhyde_dhC Semialdhyde_dh
Motif
Other DBs
NCBI-GeneID: 885118
NCBI-ProteinID: NP_218225
TubercuList: Rv3708c
UniProt: P9WNX5 I6XI10
Structure
PDB: 

Jmol
Position
complement(4151180..4152217)
Genome map
AA seq 345 aa AA seqDB search
MGLSIGIVGATGQVGQVMRTLLDERDFPASAVRFFASARSQGRKLAFRGQEIEVEDAETA
DPSGLDIALFSAGSAMSKVQAPRFAAAGVTVIDNSSAWRKDPDVPLVVSEVNFERDAHRR
PKGIIANPNCTTMAAMPVLKVLHDEARLVRLVVSSYQAVSGSGLAGVAELAEQARAVIGG
AEQLVYDGGALEFPPPNTYVAPIAFNVVPLAGSLVDDGSGETDEDQKLRFESRKILGIPD
LLVSGTCVRVPVFTGHSLSINAEFAQPLSPERARELLDGATGVQLVDVPTPLAAAGVDES
LVGRIRRDPGVPDGRGLALFVSGDNLRKGAALNTIQIAELLTADL
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgggcctgtcaatagggatcgtgggggccaccggtcaggtgggtcaggtcatgcgcacg
ttgctcgacgagcgggatttcccggcgagcgcggtgcggttcttcgcgtcggcccgatcg
cagggccgcaagctggccttccgcggccaggagatcgaagtggaagacgccgagacggcc
gacccgagcgggctggatatcgcgttgttctccgccggctcggccatgtcgaaggtgcag
gcgccccgctttgcggcggccggagtcacggtgatcgacaactcgtcggcgtggcgtaag
gaccccgacgtgccgttggtggtgtccgaggtgaactttgaacgcgacgcgcaccgccgg
cctaagggcatcatcgccaacccgaactgcaccaccatggccgcgatgccggtgctcaag
gtgctgcacgacgaagcccgactggtgcggttggtggtctcgtcgtatcaggcggtgtcc
ggtagcggcctggccggggtggccgagctggccgagcaggcgcgtgcggtcatcggtggg
gccgagcagctggtgtatgacggcggcgcgctcgagttcccgccgccgaacacctacgtc
gccccgatcgcgttcaacgtggtgccgctggccggatccctggtggacgacggctccggc
gagacagacgaggatcaaaagttgcgcttcgagagccgcaagatccttggcatccccgac
ctgttggtcagcggcacctgtgtgcgggttccggtgttcaccggacactctttgtcgatc
aacgccgagttcgcgcagccgctctcgccggagcgggcgcgcgagctgctcgacggtgct
acgggcgtgcagctggtcgacgtgccgacgccgctggccgccgccggtgtcgacgaatct
ctggtcggccggatccggcgcgacccgggggtgcccgacgggcgtggtctggcgctgttc
gtgtcgggggataacctgcgcaagggggcggcgctgaacaccatccagatcgccgagctg
ctgaccgccgacttgtga

DBGET integrated database retrieval system