KEGG   Mycobacterium tuberculosis H37Rv: Rv3709cHelp
Entry
Rv3709c           CDS       T00015                                 

Gene name
ask
Definition
(RefSeq) aspartokinase
  KO
K00928  
aspartate kinase [EC:2.7.2.4]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Glycine, serine and threonine metabolism
Monobactam biosynthesis
Cysteine and methionine metabolism
Lysine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    Rv3709c (ask)
   01230 Biosynthesis of amino acids
    Rv3709c (ask)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rv3709c (ask)
   00270 Cysteine and methionine metabolism
    Rv3709c (ask)
   00300 Lysine biosynthesis
    Rv3709c (ask)
  Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    Rv3709c (ask)
Enzymes [BR:mtu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.4  aspartate kinase
     Rv3709c (ask)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(4152218..4153483)
Genome map
AA seq 421 aa AA seqDB search
MALVVQKYGGSSVADAERIRRVAERIVATKKQGNDVVVVVSAMGDTTDDLLDLAQQVCPA
PPPRELDMLLTAGERISNALVAMAIESLGAHARSFTGSQAGVITTGTHGNAKIIDVTPGR
LQTALEEGRVVLVAGFQGVSQDTKDVTTLGRGGSDTTAVAMAAALGADVCEIYTDVDGIF
SADPRIVRNARKLDTVTFEEMLEMAACGAKVLMLRCVEYARRHNIPVHVRSSYSDRPGTV
VVGSIKDVPMEDPILTGVAHDRSEAKVTIVGLPDIPGYAAKVFRAVADADVNIDMVLQNV
SKVEDGKTDITFTCSRDVGPAAVEKLDSLRNEIGFSQLLYDDHIGKVSLIGAGMRSHPGV
TATFCEALAAVGVNIELISTSEIRISVLCRDTELDKAVVALHEAFGLGGDEEATVYAGTG
R
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
gtggcgctcgtcgtgcagaagtacggcggatcctcggtggccgacgccgaacggattcgc
cgcgtcgccgaacgcatcgtcgccaccaagaagcaaggcaatgacgtcgtcgtcgtcgtc
tctgccatgggggataccaccgacgacctgctggatctggctcagcaggtgtgcccggcg
ccgccgcctcgggagctggacatgctgcttaccgccggtgaacgcatctcgaatgcgttg
gtggccatggccatcgagtcgctcggcgcgcatgcccggtcgttcaccggttcgcaggcc
ggggtgatcaccaccggcacccacggcaacgccaagatcatcgacgtcacgccggggcgg
ctgcaaaccgcccttgaggaggggcgggtcgttttggtggccggattccaaggggtcagc
caggacaccaaggatgtcacgacgttgggccgcggcggctcggacaccaccgccgtcgcc
atggccgccgcgctgggtgccgatgtctgtgagatctacaccgacgtggacggcatcttc
agcgccgacccgcgcatcgtgcgcaacgcccgaaagctcgacaccgtgaccttcgaggaa
atgctcgagatggcggcctgcggcgccaaggtgctgatgctgcgctgcgtggaatacgct
cgccgccataatattccggtgcacgtccggtcgtcgtactcggacagaccgggcaccgtc
gttgtcggatcgatcaaggacgtacccatggaagaccccatcctgaccggagtcgcgcac
gaccgcagcgaggccaaggtgaccatcgtcgggctgcccgacatccccgggtatgcggcc
aaggtgtttagggcggtggccgacgccgacgtcaacatcgacatggtgctgcagaacgtc
tccaaggtcgaggacggcaagaccgacatcaccttcacctgctcccgcgacgtcgggccc
gccgccgtggaaaaactggactcgctcagaaacgagatcggcttctcacagctgctgtac
gacgaccacatcggcaaggtatcgctgatcggtgccggcatgcgcagccaccccggggtc
accgcgacgttctgtgaggcgctggcggcggtgggggtcaacatcgagctgatctccacc
tcggagatcaggatctcggtgttgtgccgcgacaccgaactggacaaggccgtggtcgcg
ctgcatgaagcgttcgggctcggcggcgacgaggaggccacggtgtacgcggggacggga
cggtag

DBGET integrated database retrieval system