KEGG   Mycobacterium tuberculosis H37Rv: Rv3710Help
Entry
Rv3710            CDS       T00015                                 

Gene name
leuA
Definition
(RefSeq) 2-isopropylmalate synthase
  KO
K01649  
2-isopropylmalate synthase [EC:2.3.3.13]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Valine, leucine and isoleucine biosynthesis
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    Rv3710 (leuA)
   01230 Biosynthesis of amino acids
    Rv3710 (leuA)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Rv3710 (leuA)
  Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    Rv3710 (leuA)
Enzymes [BR:mtu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.13  2-isopropylmalate synthase
     Rv3710 (leuA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
4153740..4155674
Genome map
AA seq 644 aa AA seqDB search
MTTSESPDAYTESFGAHTIVKPAGPPRVGQPSWNPQRASSMPVNRYRPFAEEVEPIRLRN
RTWPDRVIDRAPLWCAVDLRDGNQALIDPMSPARKRRMFDLLVRMGYKEIEVGFPSASQT
DFDFVREIIEQGAIPDDVTIQVLTQCRPELIERTFQACSGAPRAIVHFYNSTSILQRRVV
FRANRAEVQAIATDGARKCVEQAAKYPGTQWRFEYSPESYTGTELEYAKQVCDAVGEVIA
PTPERPIIFNLPATVEMTTPNVYADSIEWMSRNLANRESVILSLHPHNDRGTAVAAAELG
FAAGADRIEGCLFGNGERTGNVCLVTLGLNLFSRGVDPQIDFSNIDEIRRTVEYCNQLPV
HERHPYGGDLVYTAFSGSHQDAINKGLDAMKLDADAADCDVDDMLWQVPYLPIDPRDVGR
TYEAVIRVNSQSGKGGVAYIMKTDHGLSLPRRLQIEFSQVIQKIAEGTAGEGGEVSPKEM
WDAFAEEYLAPVRPLERIRQHVDAADDDGGTTSITATVKINGVETEISGSGNGPLAAFVH
ALADVGFDVAVLDYYEHAMSAGDDAQAAAYVEASVTIASPAQPGEAGRHASDPVTIASPA
QPGEAGRHASDPVTSKTVWGVGIAPSITTASLRAVVSAVNRAAR
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
gtgacaacttctgaatcgcccgacgcctataccgagtcgtttggggcccacaccatcgtg
aaacccgccggcccacctcgcgtcggtcagccctcgtggaatccgcagcgagcctcgtcg
atgccggtcaaccgctaccggccgttcgccgaggaggtcgagcccatccggctgagaaac
cgcacgtggcctgatcgcgtcatcgatcgtgcgccgctgtggtgcgcggtcgacttacgc
gatggcaaccaggcgctgatcgacccgatgagcccggcccgcaagcgccgcatgttcgac
ctgctggtccggatgggctacaaggagattgaggtggggttcccctcggccagccagacc
gacttcgacttcgtcagagagatcatcgagcagggcgccattcccgacgacgtcaccatc
caggtgctcacccaatgccgtcccgagctgatcgagcgcaccttccaggcgtgttcgggc
gcaccccgggccatcgtgcacttctacaactcgacgtcaatcctgcagcgccgcgtggtc
tttcgcgccaaccgggctgaggtgcaggccatcgcgacagatggggcgcgcaagtgcgtc
gagcaggccgccaaatacccgggcacgcagtggcgattcgagtactccccggagtcctac
accggcaccgaactggaatacgccaaacaggtgtgcgacgccgtcggcgaggtcattgcg
ccgacgccggagcgcccgatcatcttcaacctgcccgccacggtggagatgacgacgccc
aatgtctacgccgactcgatcgagtggatgagccgcaacctagccaaccgggagtcggtc
atcctgagcctgcacccgcacaatgaccgcggaaccgccgtcgccgcagcggaattgggt
ttcgcggccggggctgatcggatcgagggctgcctgttcggcaacggcgagcgcaccggc
aacgtgtgcctggtcacgctgggactcaacctgttctcccgaggtgtggacccgcagatc
gacttctccaatattgacgagatccggcgcacggtggagtactgcaaccagctgccggtg
cacgaacgtcacccctatggcggcgacctggtgtacaccgcgttctccggtagccaccag
gacgccatcaacaagggcctagacgcgatgaagctggatgcggatgccgccgactgtgac
gtcgacgacatgctgtggcaggtgccgtatctgcccatcgacccgcgcgatgtcgggcgc
acctacgaggcggtgatccgggtcaactcgcagtccggcaagggcggcgtggcctacatc
atgaagaccgaccacggcctttccctgccgcggcggctgcagatcgagttttcccaggta
atccagaagatcgcagagggtacagcaggcgagggtggcgaggtctcgcccaaggagatg
tgggatgcgttcgccgaggagtatctggccccggtgcggcctttggagcggataaggcaa
catgtggacgctgccgacgacgacggcggcacgaccagcatcacggcgaccgtcaagatc
aacggcgtggagaccgagatcagcgggtccggtaacggtccgttggccgcgttcgtccat
gcgctggccgatgtcgggtttgacgtggccgtgctggactactacgagcacgcgatgagc
gccggcgacgacgctcaggccgccgcgtatgtggaggcctccgtgacgatcgcgagcccg
gcgcagccgggcgaagcgggtcggcacgcatcggaccccgtgacgatcgcgagcccggcg
cagccgggcgaagcgggtcggcacgcatcggaccccgtgacgagtaagacggtgtggggt
gtcggtatcgcaccgtcaatcaccaccgcgtcgctgcgcgccgtggtgtcggcggtcaac
cgggcggcacgctag

DBGET integrated database retrieval system