KEGG   Mycobacterium tuberculosis H37Rv: Rv3754Help
Entry
Rv3754            CDS       T00015                                 

Gene name
tyrA
Definition
(RefSeq) prephenate dehydrogenase TyrA
  KO
K04517  
prephenate dehydrogenase [EC:1.3.1.12]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Novobiocin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rv3754 (tyrA)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rv3754 (tyrA)
  Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    Rv3754 (tyrA)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.12  prephenate dehydrogenase
     Rv3754 (tyrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
4200421..4201326
Genome map
AA seq 301 aa AA seqDB search
MRAAAAAGREVFGYNRSVEGAHGARSDGFDAITDLNQTLTRAAATEALIVLAVPMPALPG
MLAHIRKSAPGCPLTDVTSVKCAVLDEVTAAGLQARYVGGHPMTGTAHSGWTAGHGGLFN
RAPWVVSVDDHVDPTVWSMVMTLALDCGAMVVPAKSDEHDAAAAAVSHLPHLLAEALAVT
AAEVPLAFALAAGSFRDATRVAATAPDLVRAMCEANTGQLAPAADRIIDLLSRARDSLQS
HGSIADLADAGHAARTRYDSFPRSDIVTVVIGADKWREQLAAAGRAGGVITSALPSLDSP
Q
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgcgggccgccgcagcggcgggccgtgaagtctttggctacaaccggtcggtggagggt
gcccacggcgcccgctccgacgggtttgatgccataaccgatctcaaccaaacgctaacc
cgggccgccgctaccgaggcgttgatcgtgctggccgttccgatgccggccttgccaggc
atgctcgcccatattcgcaaatcggcacctggctgtccgttgaccgacgtcaccagcgtc
aaatgcgcggttctcgacgaggtcacggcggctggtctgcaggcgcgctacgtcggcggt
cacccgatgacgggcaccgcgcactcgggttggaccgccggtcacggcggcttgttcaac
agagccccctgggtggtcagcgtcgatgaccatgtcgaccccacggtgtggtcgatggtg
atgacgctggcgctggactgcggggcgatggtggtgcccgccaaatccgacgagcacgac
gccgccgctgctgccgtctcgcacctgccacacctgctcgctgaggcgctcgccgtcact
gcggccgaggtaccacttgccttcgcgttggctgcagggtctttccgcgatgccacccgg
gtggcagccaccgctcctgacctagtgcgggcaatgtgtgaagctaacaccggccaactg
gcgccggccgcggaccggatcatcgacctgctgagccgtgcgcgtgattcgctgcaatcc
cacggttcgatagccgacctcgccgacgcgggccacgccgcacgcacacgctatgacagc
ttcccgcgctccgacatcgtcaccgtcgttattggcgcggacaaatggcgcgagcaactg
gccgccgcggggcgggcgggcggggtgattacatccgctctgccaagcctggatagtcca
caatga

DBGET integrated database retrieval system