KEGG   Mycobacterium tuberculosis H37Rv: Rv3754Help
Entry
Rv3754            CDS       T00015                                 

Gene name
tyrA
Definition
(RefSeq) prephenate dehydrogenase TyrA
  KO
K04517  
prephenate dehydrogenase [EC:1.3.1.12]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Novobiocin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rv3754 (tyrA)
  Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    Rv3754 (tyrA)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.12  prephenate dehydrogenase
     Rv3754 (tyrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
4200421..4201326
Genome map
AA seq 301 aa AA seqDB search
MRAAAAAGREVFGYNRSVEGAHGARSDGFDAITDLNQTLTRAAATEALIVLAVPMPALPG
MLAHIRKSAPGCPLTDVTSVKCAVLDEVTAAGLQARYVGGHPMTGTAHSGWTAGHGGLFN
RAPWVVSVDDHVDPTVWSMVMTLALDCGAMVVPAKSDEHDAAAAAVSHLPHLLAEALAVT
AAEVPLAFALAAGSFRDATRVAATAPDLVRAMCEANTGQLAPAADRIIDLLSRARDSLQS
HGSIADLADAGHAARTRYDSFPRSDIVTVVIGADKWREQLAAAGRAGGVITSALPSLDSP
Q
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgcgggccgccgcagcggcgggccgtgaagtctttggctacaaccggtcggtggagggt
gcccacggcgcccgctccgacgggtttgatgccataaccgatctcaaccaaacgctaacc
cgggccgccgctaccgaggcgttgatcgtgctggccgttccgatgccggccttgccaggc
atgctcgcccatattcgcaaatcggcacctggctgtccgttgaccgacgtcaccagcgtc
aaatgcgcggttctcgacgaggtcacggcggctggtctgcaggcgcgctacgtcggcggt
cacccgatgacgggcaccgcgcactcgggttggaccgccggtcacggcggcttgttcaac
agagccccctgggtggtcagcgtcgatgaccatgtcgaccccacggtgtggtcgatggtg
atgacgctggcgctggactgcggggcgatggtggtgcccgccaaatccgacgagcacgac
gccgccgctgctgccgtctcgcacctgccacacctgctcgctgaggcgctcgccgtcact
gcggccgaggtaccacttgccttcgcgttggctgcagggtctttccgcgatgccacccgg
gtggcagccaccgctcctgacctagtgcgggcaatgtgtgaagctaacaccggccaactg
gcgccggccgcggaccggatcatcgacctgctgagccgtgcgcgtgattcgctgcaatcc
cacggttcgatagccgacctcgccgacgcgggccacgccgcacgcacacgctatgacagc
ttcccgcgctccgacatcgtcaccgtcgttattggcgcggacaaatggcgcgagcaactg
gccgccgcggggcgggcgggcggggtgattacatccgctctgccaagcctggatagtcca
caatga

DBGET integrated database retrieval system